[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54892.1
DDBJ      :             transporter, putative
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  228/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:388 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->386 1pw4A_ f.38.1.1 * 1.2e-41 22.7 %
:HMM:PFM   20->347 PF07690 * MFS_1 4.9e-29 24.0 325/353  
:BLT:SWISS 2->377 YYCB_BACSU 4e-40 37.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54892.1 GT:GENE ACF54892.1 GT:PRODUCT transporter, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(99257..100423) GB:FROM 99257 GB:TO 100423 GB:DIRECTION - GB:PRODUCT transporter, putative GB:NOTE identified by match to protein family HMM PF07690 GB:PROTEIN_ID ACF54892.1 GB:DB_XREF GI:194356444 LENGTH 388 SQ:AASEQ MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLGVLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVGASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILLLTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMTWLPTMSIHAGLSSHEAGLXTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVVGISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGYILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL GT:EXON 1|1-388:0| BL:SWS:NREP 1 BL:SWS:REP 2->377|YYCB_BACSU|4e-40|37.9|354/402| TM:NTM 12 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 74->96| TM:REGION 100->122| TM:REGION 128->150| TM:REGION 157->178| TM:REGION 201->223| TM:REGION 240->262| TM:REGION 269->291| TM:REGION 298->320| TM:REGION 330->352| TM:REGION 361->383| SEG 87->98|lirlinlpllyl| SEG 160->176|lillltllclatflvwl| SEG 240->250|lxtsilslisi| HM:PFM:NREP 1 HM:PFM:REP 20->347|PF07690|4.9e-29|24.0|325/353|MFS_1| HM:SCP:REP 1->386|1pw4A_|1.2e-41|22.7|383/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 238 OP:NHOMOORG 229 OP:PATTERN --------------------------------------------1----------------------- ----1---222--11---------11-----11111--111---1------1--1-------1-112-2-11---------------------------------------------------------------------------------------------------------------111-------1-------------1-1-1121--1-1111--111111111--------------2---1--1-11-1---111111111111----------1--1111111-111-------------121---111----11---1111-1-------------------11-------------------------------------------1------1----------------111-111-------------------------1------1----------------------------------1--------1-----------------1--------111---------1--1--1-11---------1-1------1---1----------------------------11-1---1----------------------111-1111-11---1--11111---1---------11--11-1111111111-1111111111111111111121-----1111111111-11111111111-1------------------------------11----------------------111--11111111-1111-1111-----------------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,181-199| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccc //