[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54903.1
DDBJ      :             3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  782/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.144.1d.115.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->203 1iezA PDBj 6e-53 47.3 %
:BLT:PDB   205->364 2bz0B PDBj 1e-44 51.9 %
:RPS:PDB   205->364 2bz1A PDBj 1e-23 50.6 %
:RPS:SCOP  5->202 1g57A  d.115.1.2 * 2e-84 47.4 %
:RPS:SCOP  204->364 2bz0A1  c.144.1.1 * 2e-58 51.3 %
:HMM:SCOP  1->202 1g57A_ d.115.1.2 * 9.7e-86 53.5 %
:HMM:SCOP  203->376 2bz1A1 c.144.1.1 * 1.7e-67 57.5 %
:RPS:PFM   6->198 PF00926 * DHBP_synthase 6e-66 59.6 %
:RPS:PFM   207->364 PF00925 * GTP_cyclohydro2 6e-59 60.8 %
:HMM:PFM   6->198 PF00926 * DHBP_synthase 2.1e-85 57.0 193/194  
:HMM:PFM   205->372 PF00925 * GTP_cyclohydro2 4.7e-75 57.7 168/169  
:BLT:SWISS 2->397 RIBBA_ACTPL e-138 58.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54903.1 GT:GENE ACF54903.1 GT:PRODUCT 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(167878..169083) GB:FROM 167878 GB:TO 169083 GB:DIRECTION - GB:PRODUCT 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II GB:NOTE identified by match to protein family HMM PF00925; match to protein family HMM PF00926; match to protein family HMM TIGR00505; match to protein family HMM TIGR00506 GB:PROTEIN_ID ACF54903.1 GB:DB_XREF GI:194356455 LENGTH 401 SQ:AASEQ MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENVNFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERGLTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCEIMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKAISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIVENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLKDLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNMEEK GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 2->397|RIBBA_ACTPL|e-138|58.1|396/401| SEG 365->376|itissrisieie| BL:PDB:NREP 2 BL:PDB:REP 3->203|1iezA|6e-53|47.3|201/217| BL:PDB:REP 205->364|2bz0B|1e-44|51.9|160/173| RP:PDB:NREP 1 RP:PDB:REP 205->364|2bz1A|1e-23|50.6|158/170| RP:PFM:NREP 2 RP:PFM:REP 6->198|PF00926|6e-66|59.6|193/194|DHBP_synthase| RP:PFM:REP 207->364|PF00925|6e-59|60.8|158/169|GTP_cyclohydro2| HM:PFM:NREP 2 HM:PFM:REP 6->198|PF00926|2.1e-85|57.0|193/194|DHBP_synthase| HM:PFM:REP 205->372|PF00925|4.7e-75|57.7|168/169|GTP_cyclohydro2| GO:PFM:NREP 4 GO:PFM GO:0008686|"GO:3,4-dihydroxy-2-butanone-4-phosphate synthase activity"|PF00926|IPR000422| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF00926|IPR000422| GO:PFM GO:0003935|"GO:GTP cyclohydrolase II activity"|PF00925|IPR000926| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF00925|IPR000926| RP:SCP:NREP 2 RP:SCP:REP 5->202|1g57A|2e-84|47.4|194/205|d.115.1.2| RP:SCP:REP 204->364|2bz0A1|2e-58|51.3|156/168|c.144.1.1| HM:SCP:REP 1->202|1g57A_|9.7e-86|53.5|202/209|d.115.1.2|1/1|YrdC/RibB| HM:SCP:REP 203->376|2bz1A1|1.7e-67|57.5|174/0|c.144.1.1|1/1|RibA-like| OP:NHOMO 1678 OP:NHOMOORG 962 OP:PATTERN 11-1111111111111--1111121-11-1111111111111112111111111-1-111-211--11 2221311111121111122-2111212222222111215511112-111111-322122222312234311----1-----12111111212-111---2121111112111111111111111111121111121222-111111111111211111111111111111111111111111111111---1111111121311112111111311111112211------1311111111111111111111--1----2---1111----111-111111-------11111111111-----------------------11-11222211311111111111-111--1111111211211111-1-11111-111111112111111111111-1111111111-11211211111112211212221122111223222222211111111211112232222222222---------------222212443222222344335344443333444424444444311222411221111112211213312222222111211122121222222221212311122332324113222222222222222222222222223342223123233333233333333333332-1111122-22222222222222222222-2222222222222222222222223322222222222222222222222222222222222232222221111111112133111132212222122233333332223222224333344442333111111111122243333354344222222222222221111111111----------1----------------1--------11-111-111111 ------1-----2222223222222222222222222222222222222222222222222222222222222222222222222222-23222222222242232-25-------------------------------------------------1----1-----------1222N2212213462332254331 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 90.3 SQ:SECSTR ##THHHHHHHHHHHTcccEEEEccccccccccccccTTcccHHHHHHHHHHcccccEEEEcHHHHHHTTccccccccTTccccccccccccTTccccccTTHHHHHHHHHTcccccccccccccccEEEEcccccTTccccccHHHHHHHHTTTccccccccccccTTcccccHHHHHHHHHHHHcEEEEcHHHHHHHHHHHccEEEEEEEEEEETTEEEEEEEEEETTTccEEEEEEEccccccccEEEEEEEccHHHHTcccccccHHHHHHHHHHHHHHHTcEEEEEEccHHHHTcHHHHHHHHHHHHTTccHHHHHHHTTcccccccTHHHHHHHHHTTcccEEEEcccHHHHHHHHHTT##################################### DISOP:02AL 1-3,398-402| PSIPRED ccccHHHHHHHHHHcccEEEEEEcccccccEEEEEEHHHccHHHHHHHHHHccccEEEEccHHHHHHcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHcccccHHHHcccccccEEEEcccccccccccHHHHHHHHHHccccEEEEEEEEEccccccccHHHHHHHHHHHccEEEEHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEEccccccEEEEEEEccccccccccEEEEccccHHHHHccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHcccccccccc //