[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54911.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y870_STRZT   RecName: Full=UPF0223 protein SPT_0870;

Homologs  Archaea  0/68 : Bacteria  119/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.276.1
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->85 2oy9A PDBj 2e-16 43.6 %
:RPS:SCOP  6->88 2oy9A1  a.276.1.1 * 8e-30 42.2 %
:RPS:PFM   5->90 PF05256 * UPF0223 5e-23 67.4 %
:HMM:PFM   3->89 PF05256 * UPF0223 6.4e-41 59.8 87/88  
:BLT:SWISS 1->92 Y870_STRZT 1e-48 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54911.1 GT:GENE ACF54911.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1310856..1311134) GB:FROM 1310856 GB:TO 1311134 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF54911.1 GB:DB_XREF GI:194356463 LENGTH 92 SQ:AASEQ MNKQYSYPLDLSWSTEELASVLSFFNDVEAAYEGKVEAKKLLDSYKGFKAVVPSKSEEKRLGREFETVSGYSLYRAVQAAKEKGEGKISLGK GT:EXON 1|1-92:0| SW:ID Y870_STRZT SW:DE RecName: Full=UPF0223 protein SPT_0870; SW:GN OrderedLocusNames=SPT_0870; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->92|Y870_STRZT|1e-48|100.0|92/92| BL:PDB:NREP 1 BL:PDB:REP 8->85|2oy9A|2e-16|43.6|78/83| RP:PFM:NREP 1 RP:PFM:REP 5->90|PF05256|5e-23|67.4|86/88|UPF0223| HM:PFM:NREP 1 HM:PFM:REP 3->89|PF05256|6.4e-41|59.8|87/88|UPF0223| RP:SCP:NREP 1 RP:SCP:REP 6->88|2oy9A1|8e-30|42.2|83/85|a.276.1.1| OP:NHOMO 119 OP:NHOMOORG 119 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111-11111111111---11111111111111111111-1-11-1---11111111111-111111111111-1111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 84.8 SQ:SECSTR #######cccccccHHHHHHHHHHHHHHHHHHTTcEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHTTccccHHHHHHHHHHccc####### DISOP:02AL 1-2,86-87,92-93| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHcccc //