[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54916.1
DDBJ      :             acyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->78 1dv5A_ a.28.1.3 * 2.8e-13 37.7 %
:HMM:PFM   9->72 PF00550 * PP-binding 2.8e-12 27.9 61/67  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54916.1 GT:GENE ACF54916.1 GT:PRODUCT acyl carrier protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 37906..38139 GB:FROM 37906 GB:TO 38139 GB:DIRECTION + GB:PRODUCT acyl carrier protein GB:PROTEIN_ID ACF54916.1 GB:DB_XREF GI:194356468 LENGTH 77 SQ:AASEQ MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFILTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK GT:EXON 1|1-77:0| SEG 27->41|slslkddldadsvdl| SEG 49->62|edefsieisdeeid| HM:PFM:NREP 1 HM:PFM:REP 9->72|PF00550|2.8e-12|27.9|61/67|PP-binding| HM:SCP:REP 2->78|1dv5A_|2.8e-13|37.7|77/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHcc //