[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54920.1
DDBJ      :             acetyltransferase, GNAT family protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  302/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->154 3fbuB PDBj 2e-13 31.4 %
:RPS:PDB   16->189 3eg7F PDBj 1e-19 14.7 %
:RPS:SCOP  14->155 2fckA1  d.108.1.1 * 2e-38 24.1 %
:HMM:SCOP  8->182 2fckA1 d.108.1.1 * 2.4e-43 36.6 %
:HMM:PFM   76->153 PF00583 * Acetyltransf_1 2.3e-09 23.4 77/83  
:BLT:SWISS 11->154 YOAA_BACSU 2e-19 35.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54920.1 GT:GENE ACF54920.1 GT:PRODUCT acetyltransferase, GNAT family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 847506..848075 GB:FROM 847506 GB:TO 848075 GB:DIRECTION + GB:PRODUCT acetyltransferase, GNAT family protein GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF54920.1 GB:DB_XREF GI:194356472 LENGTH 189 SQ:AASEQ MESIFVKFAQYPSIETERLLLRPVTLDDAEAMFDYASDKGNTRYTFPTNQSLEETKNNIAQFYLANPLGRWGIELKSNGQFIGTIDLHKIDSVLKKAAIGYIINKKYWNQGLTTEANRAVIELAFEKIGMNKLTALHDKDNPASGKVMEKSGMRFSHAEPYACMDQHEKDRIVTRVHYVLTKEDYFANK GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 11->154|YOAA_BACSU|2e-19|35.4|144/177| BL:PDB:NREP 1 BL:PDB:REP 14->154|3fbuB|2e-13|31.4|137/166| RP:PDB:NREP 1 RP:PDB:REP 16->189|3eg7F|1e-19|14.7|170/171| HM:PFM:NREP 1 HM:PFM:REP 76->153|PF00583|2.3e-09|23.4|77/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 14->155|2fckA1|2e-38|24.1|141/174|d.108.1.1| HM:SCP:REP 8->182|2fckA1|2.4e-43|36.6|172/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 600 OP:NHOMOORG 314 OP:PATTERN ---------------------------------------------12-----------21--1----- ----2--------------------1-----------1---2----11-11----1----12-1211-221-111-----3---------11-2111--11232-3-2-1------------------------1--------12-111-----------------21211--------------1-------166666A961665879445542566--19333122221331--------------211-21--2--2-11122--111-111-22243423334113444444444411111111111113221112221-13-3212213112--111121-3-111--3--22--------1-2--1---1------------12--111--1-------------1-1-----12-311-------1--1--1------------------------2--------------111111-1-11------1-1--------11111---------------1---1-----------------1-------2-------------------------1----------------1---1-----------1--------------11--21111---121211121221122122---------------11----------------------------------2-11112----------------2---------1--------------111111-432--1-----------------221121--1--11--1-3-----1-1111------------122-11--1-33-31--------------3----11----------2------------------2------11----1-----1 ----11-----------1--------------------------------------------------------------------------------------------------------------------------------------------1--------------------------2--1-3-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 94.7 SQ:SECSTR ##########EEEEEcTTcEEEEccGGGHHHHHHHHHTcccEEETTEEEccHHHHHHHHHHHTTcccTcEEEEEEcTTccEEEEEEEEEEETTTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEEEcEEccccEEEEEEEEEHHHHHHTTc DISOP:02AL 188-190| PSIPRED cccEEEEcccccEEEcccEEEEEccHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEEEcccccccEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEccccccccccEEEEEEEEEEEHHHHHHcc //