[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54923.1
DDBJ      :             amino acid ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  701/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   81->163 3dhwA PDBj 1e-05 26.5 %
:RPS:PDB   121->156 3dhwA PDBj 3e-09 43.8 %
:RPS:SCOP  1->183 2r6gG1  f.58.1.1 * 9e-22 16.9 %
:RPS:PFM   34->161 PF00528 * BPD_transp_1 2e-04 31.5 %
:HMM:PFM   31->221 PF00528 * BPD_transp_1 1.6e-23 21.8 179/185  
:BLT:SWISS 3->221 GLNP_RICFE 2e-37 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54923.1 GT:GENE ACF54923.1 GT:PRODUCT amino acid ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 725457..726140 GB:FROM 725457 GB:TO 726140 GB:DIRECTION + GB:PRODUCT amino acid ABC transporter, permease protein GB:NOTE identified by match to protein family HMM PF00528; match to protein family HMM TIGR01726 GB:PROTEIN_ID ACF54923.1 GB:DB_XREF GI:194356475 LENGTH 227 SQ:AASEQ MNFSFLPKYLPYFNYGAVVTILISICVIFLGTILGVVLAFGQRSKFKPLVWLANLYVWIFRGTPMMVQIMIAFALMHINAPTIQIGILGVDFSRLIPGILIISMNSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKNAMRYVILPQAVKNILPALGNEFITIIKDSSLLSAIGVMELWNGATTVSTTTYLPLTPLLFAAFYYLIMTSILTVALKAFEKHMGQGDKK GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 3->221|GLNP_RICFE|2e-37|40.3|211/218| TM:NTM 5 TM:REGION 15->37| TM:REGION 51->73| TM:REGION 94->116| TM:REGION 167->189| TM:REGION 194->216| SEG 187->202|tttylpltpllfaafy| BL:PDB:NREP 1 BL:PDB:REP 81->163|3dhwA|1e-05|26.5|83/203| RP:PDB:NREP 1 RP:PDB:REP 121->156|3dhwA|3e-09|43.8|32/203| RP:PFM:NREP 1 RP:PFM:REP 34->161|PF00528|2e-04|31.5|124/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 31->221|PF00528|1.6e-23|21.8|179/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 1->183|2r6gG1|9e-22|16.9|178/284|f.58.1.1| OP:NHOMO 4554 OP:NHOMOORG 735 OP:PATTERN 11--12----------1-1111114--21-2211----1122--2222--1-1----2------2--- ----4313333321411----6--1D------766636C914225283433-758135--2121577A5A4655565521421---------------------------11111111111111-----1--4---222441111-2234223332211121--1--3322-2222--2222-1341111--27455555875566556623398556333754355555396222222222222222222246757AB885666666A93756C533388886664AA888777888876666566666666788BA98888135575645455232344423332122142331AA-4132-1111111171--11137444422K67222422222375347567R-22G22D28DK23oTTPUXUVUiMNN9---25L555734B1111111134511-4A----------111111111111111--1-5--21-5HFBHNMMMPKC9DDDFFJTEDEEADHGb778412B9C94854CAFGLO244----A43322222---24-11L-997C56CAAA42-23-3-------1--5-3341555553342222222-13----9AC-3-----B-1111--11111111-11-2---1--------BBLK6DBAAAAAA8AA9-AACAAAAAAAAAA9AA99BIMGNM776A897A9AAA999A989F998999931FBBBBBAABBBB--4-222221111--78F33342533223333266666-64553-GEEGIPKTAHJDF5MKL----------777A99999AA97711---------------2----------------3526----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 36.6 SQ:SECSTR ################################################################################cHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHH################################################################ DISOP:02AL 223-228| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //