[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54929.1
DDBJ      :             membrane protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  260/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->348 2fqwA PDBj 4e-47 38.2 %
:RPS:PDB   41->265 3dbiC PDBj 3e-09 13.1 %
:RPS:SCOP  37->310 1bdhA2  c.93.1.1 * 6e-12 13.0 %
:HMM:SCOP  37->316 1rpjA_ c.93.1.1 * 1.3e-14 17.5 %
:RPS:PFM   41->338 PF02608 * Bmp 4e-39 47.7 %
:HMM:PFM   40->348 PF02608 * Bmp 6.1e-71 39.3 290/306  
:BLT:SWISS 41->350 TCSA_LISMO 2e-71 46.9 %
:PROS 229->235|PS00227|TUBULIN
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54929.1 GT:GENE ACF54929.1 GT:PRODUCT membrane protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 741450..742502 GB:FROM 741450 GB:TO 742502 GB:DIRECTION + GB:PRODUCT membrane protein GB:NOTE identified by match to protein family HMM PF02608 GB:PROTEIN_ID ACF54929.1 GB:DB_XREF GI:194356481 LENGTH 350 SQ:AASEQ MNKKQWLGLGLVAVAAVGLAACGNRSSRNAASSSDVKTKAAIVTDTGGVDDKSFNQSAWEGLQDWGKEHNLSKDNGFTYFQSTSEADYANNLQQAAGSYNLIFGVGFALHNAVEEAAKEHTDLNYVLIDDVIKDQKNVASVTFADNESGYLAGVAAAKTTKTKQVGFVGGIESEVISRFEAGFKAGVASVDPSIKVQVDYAGSFGDAAKGKTIAAAQYAAGADIVYQVAGGTGAGVFAEAKSLNESRPENEKVWVIGVDRDQEAEGKYTSKDGKESNFVLVSTLKQVGTTVKDISNKAEKGEFPGGQVIVYSLKDKGVDLAVTNLSEEGKKAVEDAKAKILDGSVKVPEK GT:EXON 1|1-350:0| BL:SWS:NREP 1 BL:SWS:REP 41->350|TCSA_LISMO|2e-71|46.9|309/357| PROS 229->235|PS00227|TUBULIN|PDOC00199| TM:NTM 1 TM:REGION 7->29| SEG 7->21|lglglvavaavglaa| SEG 24->34|nrssrnaasss| SEG 155->163|aaakttktk| SEG 206->224|daakgktiaaaqyaagadi| BL:PDB:NREP 1 BL:PDB:REP 42->348|2fqwA|4e-47|38.2|296/316| RP:PDB:NREP 1 RP:PDB:REP 41->265|3dbiC|3e-09|13.1|213/268| RP:PFM:NREP 1 RP:PFM:REP 41->338|PF02608|4e-39|47.7|277/288|Bmp| HM:PFM:NREP 1 HM:PFM:REP 40->348|PF02608|6.1e-71|39.3|290/306|Bmp| GO:PFM:NREP 1 GO:PFM GO:0008289|"GO:lipid binding"|PF02608|IPR003760| RP:SCP:NREP 1 RP:SCP:REP 37->310|1bdhA2|6e-12|13.0|261/282|c.93.1.1| HM:SCP:REP 37->316|1rpjA_|1.3e-14|17.5|268/288|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 386 OP:NHOMOORG 285 OP:PATTERN 111-11------------11111-22211-1-------------1---------1111111---1--- ----1---------------------------------------211-1221---1----1121111221--------1---1------------------------------------------1111111111111111---1--1-------------------1-11------------3211111-1221111111111111111-1121111211213211111121--------------------22-3--3-111---------22111122231111111111111111122222222222221111111112112121111111111-2--1222311111----11-1--111-11111-12------------------------111-1-11111---------11--111111211132-----1111111111---------11---1------------------------------------1-------------------------------------1-----------------2--------------1---------2-----------------11-1---------------------------1-1-------1-------1------1--1----------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------4------64445344111-------------------------1242214111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 312 STR:RPRED 89.1 SQ:SECSTR ####################################cEEEEEEEcTTTTccccHHHHHHHHHHHHHHHTTcEEEEEEcTTcHHHHHHHHHHHHHHTTTccEEEccccccHHHHHHHHHHcccccEEEcccccccccGGGEEccccHHHHHHHHHHHHHHTTcccEEEEcccTcHHHHHHHHHHHHHHHHTTccccGGGEEcccccHHHHHHHHHHHHTTccccEEEEccHHHHHHHHHHHTTccccTTTTTTcEEEEEcccTTGGcTccEGcccccEEEEcccHHHHHHHHHHHHHHHHcccccccEEEEcEEEEccEEcccTTccHHHHHHHHHHHHHHHTTccccc## DISOP:02AL 1-2,24-37,350-351| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEcHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcHHHcccccEEEEEEcccHHHHHHHcccccccccEEEEEEEEcHHHHHHHHHHHHHccccccccEEEEEcccccEEcccccccHHHHHHHHHHHHHHHcccEEcccc //