[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54936.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  141/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->109 PF03780 * DUF322 1e-11 35.3 %
:HMM:PFM   7->108 PF03780 * DUF322 3e-31 38.2 102/108  
:BLT:SWISS 5->129 Y1535_STRP6 2e-41 61.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54936.1 GT:GENE ACF54936.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(386302..386691) GB:FROM 386302 GB:TO 386691 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF03780 GB:PROTEIN_ID ACF54936.1 GB:DB_XREF GI:194356488 LENGTH 129 SQ:AASEQ MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSKLSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIHVAGIVPDKTPKPELKDLFDEDFLND GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 5->129|Y1535_STRP6|2e-41|61.6|125/129| RP:PFM:NREP 1 RP:PFM:REP 8->109|PF03780|1e-11|35.3|102/107|DUF322| HM:PFM:NREP 1 HM:PFM:REP 7->108|PF03780|3e-31|38.2|102/108|DUF322| OP:NHOMO 144 OP:NHOMOORG 141 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11---------------111111---111-1--1111112-111111111111111111-11111111111111111111-111111111111111111111111111111111111111111111111111-11-111111--1--1111111111--111-122---11-1-1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,124-130| PSIPRED ccccccccEEEEcHHHHHHHHHHHHHHcccEEEEccccHHHHHccccccccEEEEEEccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEccccccccHHHHcccccccc //