[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54937.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->31 PF12555 * TPPK_C 0.00046 23.8 21/53  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54937.1 GT:GENE ACF54937.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1529244..1529378) GB:FROM 1529244 GB:TO 1529378 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54937.1 GB:DB_XREF GI:194356489 LENGTH 44 SQ:AASEQ MTKIFGWILRIAVLAADVYGNFANNIAAAWDAHDKIPNNGRINF GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 2->24| HM:PFM:NREP 1 HM:PFM:REP 11->31|PF12555|0.00046|23.8|21/53|TPPK_C| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-45| PSIPRED cHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccc //