[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54942.1
DDBJ      :             L-lactate oxidase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  423/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->364 2j6xA PDBj e-109 52.7 %
:RPS:PDB   13->361 2a7nA PDBj 2e-51 28.1 %
:RPS:SCOP  12->355 1al7A  c.1.4.1 * 1e-45 38.4 %
:HMM:SCOP  13->362 1huvA_ c.1.4.1 * 5e-92 37.3 %
:RPS:PFM   24->354 PF01070 * FMN_dh 8e-71 44.4 %
:HMM:PFM   24->356 PF01070 * FMN_dh 6e-110 41.9 332/355  
:BLT:SWISS 14->347 HAOX_DICDI 1e-61 36.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54942.1 GT:GENE ACF54942.1 GT:PRODUCT L-lactate oxidase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 635014..636150 GB:FROM 635014 GB:TO 636150 GB:DIRECTION + GB:PRODUCT L-lactate oxidase GB:NOTE identified by match to protein family HMM PF01070; match to protein family HMM TIGR02708 GB:PROTEIN_ID ACF54942.1 GB:DB_XREF GI:194356494 LENGTH 378 SQ:AASEQ MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFTLRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKXSSPIIMAPVAAHKLANEQGEVATARGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKDEGYKAIVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVEFIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAVDRRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELKTVMQLSGAQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 14->347|HAOX_DICDI|1e-61|36.8|334/388| BL:PDB:NREP 1 BL:PDB:REP 1->364|2j6xA|e-109|52.7|364/370| RP:PDB:NREP 1 RP:PDB:REP 13->361|2a7nA|2e-51|28.1|345/353| RP:PFM:NREP 1 RP:PFM:REP 24->354|PF01070|8e-71|44.4|322/328|FMN_dh| HM:PFM:NREP 1 HM:PFM:REP 24->356|PF01070|6e-110|41.9|332/355|FMN_dh| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01070|IPR000262| RP:SCP:NREP 1 RP:SCP:REP 12->355|1al7A|1e-45|38.4|341/350|c.1.4.1| HM:SCP:REP 13->362|1huvA_|5e-92|37.3|346/0|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 1357 OP:NHOMOORG 608 OP:PATTERN -----------------------1----1--1-----------------------------1------ --3141-111111-24422-22113322222222224252-3232111----1111-1--212-31512-1-----------3-----------------1---1---------------------------------------21-1-------------------1112--11-----11-1211----1-----------------------------1---------1-------------------------12--1-111--222-1---1-----1------222221222221111111111111-----------11--1111111-1-12---1112------1-----1---12--------11-1221-11111-3221111111111111111111---1--1-3232-333333133335412212351111323---------111-1-------------------------------11241-23232-1121-3333222133333-3--51331-1---1223363212211---1---111111111--3---2-1111-11111----1----------1--1-1----------------------------1-1-1----------------------------------11---1-1111122111-111111111111111111122211121211222122122222211111111---11111111111---------------122111-1-11111---111111111131122221--221111---1212222221-----11111-11--1111111111-------1111111------------------------------------------------- ----11------1119C88A876EEFC44344433334343444445567ADNG57633444233-23211241221-1221111211-7E5C3736562413112-1--M222224222221222232573-22322222225122212222422223332-5121223132721112H1211154A77722242216 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 377 STR:RPRED 99.7 SQ:SECSTR ccccccccccccccccHHHHHHHHHHHccHHHHHHHHcccTTcHHHHHHHHGGGGEEEccccccccccccccEEETTEEEcccEEEcccccGGGTcTTHHHHHHHHHHHHTccEEEcTTcccccHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHTTccEEEEEcccccccccHHHHHHTccccTTcccGGGTccTTTHHHHHHTcccccTTccHHHHHHHHHHcccEEEEEEEccHHHHHHHHHTTccEEEEccGGGTccTTcccGGGcHHHHHHHHcTcccEEEccccccHHHHHHHHHTTcccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccGGGccGGGEEEccccEEccHHHHHHHH# DISOP:02AL 1-7| PSIPRED cccccccccccccEEcHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccEEEccccccccccHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHccccccccccHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHccccEEEEccccHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccEEEccccccccccccccccc //