[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54945.1
DDBJ      :             ABC transporter ATP-binding protein, point mutation
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:131 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->120 2oukB PDBj 2e-35 55.8 %
:RPS:PDB   2->118 1aroP PDBj 8e-30 9.4 %
:RPS:SCOP  1->120 1b0uA  c.37.1.12 * 3e-28 50.8 %
:HMM:SCOP  1->101 1ii8.1 c.37.1.12 * 2e-38 53.0 %
:RPS:PFM   1->48 PF00005 * ABC_tran 5e-10 50.0 %
:HMM:PFM   2->48 PF00005 * ABC_tran 2.5e-14 48.9 47/118  
:HMM:PFM   40->84 PF07090 * DUF1355 0.001 28.9 45/177  
:BLT:SWISS 3->119 ARTM_BACSU 4e-38 57.3 %
:PROS 20->34|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54945.1 GT:GENE ACF54945.1 GT:PRODUCT ABC transporter ATP-binding protein, point mutation GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(630335..630730) GB:FROM 630335 GB:TO 630730 GB:DIRECTION - GB:PRODUCT ABC transporter ATP-binding protein, point mutation GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF54945.1 GB:DB_XREF GI:194356497 LENGTH 131 SQ:AASEQ MQLLXRVGLLDKQHSFARQLSGGQKQRVAIVRALLMHPEIILFDEVTASLDPEMVREVLELINDLAQEGRTMILVTHEMQFAQAIADRIIFLDQGKIAEEGTAQAFFTNPQTKRAQEFLNVFDFSQFGSYL GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 3->119|ARTM_BACSU|4e-38|57.3|117/240| PROS 20->34|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->120|2oukB|2e-35|55.8|120/241| RP:PDB:NREP 1 RP:PDB:REP 2->118|1aroP|8e-30|9.4|117/774| RP:PFM:NREP 1 RP:PFM:REP 1->48|PF00005|5e-10|50.0|48/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 2->48|PF00005|2.5e-14|48.9|47/118|ABC_tran| HM:PFM:REP 40->84|PF07090|0.001|28.9|45/177|DUF1355| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->120|1b0uA|3e-28|50.8|120/258|c.37.1.12| HM:SCP:REP 1->101|1ii8.1|2e-38|53.0|100/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 39502 OP:NHOMOORG 1173 OP:PATTERN NNH8JAGENNNLNKQIfEMJEGENoNPefOfPFAD8ACGFGECPWLPgKO**d8NWMJOHOFHBQ147 OWZJ*TWTbbdTPNQLLGF-FW88R*GGGGGIhZYZi***JrP*humahdVLnqjIMWAAlrdR*bt***UURRRmWUSN*bcAAB8BLMIF4FADH--BCPGHETHPIK8999999CCCAAAAFQOJNRIJOQULbghtqGFEtTncclZZbTaQQHCIDFEZWTd***VCFDBBCCIBABDYSUKKqeAOXp********y********ttur***Yer**chmmnikj**WdeeeebbcddddccUXTWTpTWQqrQNTQWomMNssURNWaaccdmjlnomrlonjlhkgeilfhjabaZZbcbccbZatdbZYXdcdid*pu********X*ae*vvPXWU*fake*VbPJ**kgVVggQWbXeZIXVPHXTPPHIIIFGUP***RKf****ux*y**w*zuz*-Xb*YV*X***O7**************DFHu***v*****KJKKKKKKmQTHKcQz55444444452444AB4566464466575HBED9A***z*******rrstp*****y**f*******zBMljl*gnjo*v****TgeMNHLbRFFFFFEFMNNTcdYr*NaPfdNcjVUgGUYTSPVdOYONLMejTsGHGMCJJIJHH889998899BOEBEMLhbeIlNYDPKrLQSSPIQVNLLOPOTTPSR5-BHRPI121111zl**T*ljnnokqprgh-miiimlnjlkmrlhiihhg*****eeaceYbdcccbcbbcbbb*dbchhhhM1v***********12EGCDBCDLMNLLD*c*WXVSSRHMOKKOINWJMNLMCNGJQdTllglm*w*juxlmb***EDCABDCBDIZlkvikkjkrvoqrONMLKLLIJIBAAA35GPMMFFII67757655*8ODCCCD-C9DFGFBMNL7FEBHB888QZjOPhzjkeASG 2311RKA-PC27KOFB6DAAEKBK8KEAA7978IGF8EFDBCC878CDFLGGKHBEFD999972233623424434311352244425-AA86ECA878B96BDE63CScgNXQhSVIDG9KQHfgDoA**h2jPdGDE9ZDGRIBIGCETBB*DSIJdCU*8bJF9TKR*WbML9AA9*685DGXQX*7XaBCdPUUG ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHGGTcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHTTTcccccTTHHHHHTccHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHEEHTccccT PSIPRED cHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHccHHHHHHcc //