[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54946.1
DDBJ      :             MATE efflux family protein
Swiss-Prot:NORM_STRPN   RecName: Full=Probable multidrug resistance protein norM;AltName: Full=Multidrug-efflux transporter;

Homologs  Archaea  4/68 : Bacteria  429/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
:453 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   265->397 PF01554 * MatE 2e-07 29.3 %
:HMM:PFM   20->180 PF01554 * MatE 6e-31 33.5 161/162  
:HMM:PFM   246->406 PF01554 * MatE 3.9e-34 21.1 161/162  
:BLT:SWISS 1->453 NORM_STRPN 0.0 99.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54946.1 GT:GENE ACF54946.1 GT:PRODUCT MATE efflux family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1042796..1044157) GB:FROM 1042796 GB:TO 1044157 GB:DIRECTION - GB:PRODUCT MATE efflux family protein GB:NOTE identified by match to protein family HMM PF01554; match to protein family HMM TIGR00797 GB:PROTEIN_ID ACF54946.1 GB:DB_XREF GI:194356498 LENGTH 453 SQ:AASEQ MYKTKCLREKLVLFLKIFFPILIYQFANYSASFVDTAMTGQYNTMDLAGVSMATSIWNPFFTFLTGIVSALVPIIGHHLGRGKKEEVASDFYQFIYLALGLSVVLLGMVLFLAPIILNHIGLEAAVAAVAVRYLWFLSIGIIPLLLFSVIRSLLDSLGLTKLSMYLMLLLLPLNSGFNYLLIYGAFGVPELGGAGAGLGTSLAYWVLLGISVLVLFKQEKLKALHLEKRIPLNMDKIKEGVRLGLPIGGTVFAEVAIFSVVGLIMAKFSPLIIASHQSAMNFSSLMYAFPMSISSAMAIVVSYEVGAKRFDDAKTYIGLGRWTALIFAAFTLTFLYIFRGNVASLYGNDPKFIDLTVRFLTYSLFFQLADTFAAPLQGILRGYKDTVIPFYLGLLGYWGVAIPVATLFDSLTDFGAYSYWIGLIISLIVSGALYRWRLTVIMKRFESLAKSKC GT:EXON 1|1-453:0| SW:ID NORM_STRPN SW:DE RecName: Full=Probable multidrug resistance protein norM;AltName: Full=Multidrug-efflux transporter; SW:GN Name=norM; OrderedLocusNames=SP_1166; SW:KW Antiport; Cell membrane; Complete proteome; Ion transport; Membrane;Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->453|NORM_STRPN|0.0|99.8|453/453| GO:SWS:NREP 6 GO:SWS GO:0015297|"GO:antiporter activity"|Antiport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 10->32| TM:REGION 51->73| TM:REGION 93->115| TM:REGION 129->151| TM:REGION 165->187| TM:REGION 198->219| TM:REGION 246->268| TM:REGION 283->305| TM:REGION 318->340| TM:REGION 387->409| TM:REGION 414->435| SEG 97->112|lalglsvvllgmvlfl| SEG 157->181|lgltklsmylmllllplnsgfnyll| SEG 191->199|lggagaglg| RP:PFM:NREP 1 RP:PFM:REP 265->397|PF01554|2e-07|29.3|133/161|MatE| HM:PFM:NREP 2 HM:PFM:REP 20->180|PF01554|6e-31|33.5|161/162|MatE| HM:PFM:REP 246->406|PF01554|3.9e-34|21.1|161/162|MatE| GO:PFM:NREP 5 GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| OP:NHOMO 675 OP:NHOMOORG 531 OP:PATTERN ----1--------------------------------------------------1---11------- 1-1---------------------------------1------------------------------1--------------------11-2-1-----11111-11111------------------------------------------------------1------------------111---1--22111111113111111-12222112222211222222212----------------------------------------------111----1--11111111111-------------143111111--11---------111----1---1111111---11-1-111---11-1-1-----------1----111111111--11-111111---------1-1-111111111111------211111111---------111--12------------------------------1111--1-1-222222222222222222222221-1-111111-111111111--------111111111---1111-------1-1---11-11---1-1-1-1----11-------1----------1-----22211-111111222212122221211211--1-----1----111111-1111111111-11111111111111111111111233211111111111111111111-111--111111111111---11-11------1-1111111111111111122222111111111112222111111111---------11221111113222211111111111111----------------------------------------------1-11111111-11 ----23--111-11221-11111-1-111-1111111111-11-11-1--21211-211323224122-31142321122133334---1111112--111-1332-1-321-1---------------------------------------3-2-1-----1-------------1--1--------21--111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //