[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54955.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:215 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->204 1l2tB PDBj 3e-37 43.6 %
:RPS:PDB   1->195 2dwoA PDBj 6e-38 8.7 %
:RPS:SCOP  2->193 1sgwA  c.37.1.12 * 3e-40 20.6 %
:HMM:SCOP  6->207 1ii8.1 c.37.1.12 * 3e-56 39.4 %
:RPS:PFM   45->157 PF00005 * ABC_tran 4e-14 51.0 %
:HMM:PFM   45->157 PF00005 * ABC_tran 7.8e-24 38.7 111/118  
:HMM:PFM   17->53 PF03193 * DUF258 5.5e-06 27.8 36/161  
:HMM:PFM   159->208 PF02882 * THF_DHG_CYH_C 0.00061 38.0 50/161  
:BLT:SWISS 1->214 YCLH_BACSU 1e-51 46.3 %
:PROS 130->144|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54955.1 GT:GENE ACF54955.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 528630..529277 GB:FROM 528630 GB:TO 529277 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF54955.1 GB:DB_XREF GI:194356507 LENGTH 215 SQ:AASEQ MTLLQLQDVTYRYKNTAEAVLYQINYNFEPGKFYSIIGESGAGKSTLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLVNKKASKNTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPKTAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 1->214|YCLH_BACSU|1e-51|46.3|214/226| PROS 130->144|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 3->204|1l2tB|3e-37|43.6|202/232| RP:PDB:NREP 1 RP:PDB:REP 1->195|2dwoA|6e-38|8.7|183/449| RP:PFM:NREP 1 RP:PFM:REP 45->157|PF00005|4e-14|51.0|104/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 45->157|PF00005|7.8e-24|38.7|111/118|ABC_tran| HM:PFM:REP 17->53|PF03193|5.5e-06|27.8|36/161|DUF258| HM:PFM:REP 159->208|PF02882|0.00061|38.0|50/161|THF_DHG_CYH_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 2->193|1sgwA|3e-40|20.6|189/200|c.37.1.12| HM:SCP:REP 6->207|1ii8.1|3e-56|39.4|198/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48752 OP:NHOMOORG 1173 OP:PATTERN TTKAQIJHWVVRVQcNhJPKJNJWmJOZZNWPIEDEE9GGHFCPVQThJP*uc7QcPTUNSNKDW189 UZiK*dbYmmnSXQUPPJJ-Jb99U*JJJJJNnkjlo***MkR*sumdpgYNx*wMRbDEqqse*kt***VYWWW*gccQ*giBBC9CUTUQ7KFJL--HGXNNMlPZPX8788887BCDAAAAJTOKPXPMRSYQjqqzxKJI*TujktedmafSSQMNKQHacWl***aKRHOLIJSJNHHaVYNLulAUes************************fmv**iowuvrsw**XqrsqsonpqqqqppYidff*kbd**cRkdqtsRS**aWRXkkjjltswyxs**xxsvssqoswqstffgfdgiihggee*qlhginmqlr***********j*my***cllh*yj**ymrQI**wkVbhoTakenlPbbVKdXTTLKIKJMdW***VPk****************-fl*gd*k***QD**************KFK**********POPPPPPPsWaGQgV*67677666667988CD89CA8B88B98A6JDFFCG***u********vuwp********e********AOwvq*crgk*z****bldNZJRlTKLKJMLKSSPVkff**RfTunYgxcajJbYXVRVfUWRTRVoxXzNLMTHPPPPOJACDDEEDEDJUEFLJIsq*VoWhKWQ*RUVXVPWdXXXSSXcXVeg6-DIOPN331222****Z*w********yz-**y*zz*z*****wxzxww*****otkptnoqpqpqqnorooo*snquutxU4************55ILEJEEFOPQPMI*n*cbaabbMRURPWQUhOPQQPFRHNTmf**yxu***t**uzh***HHGEGIHGHNjsr*rssss*****LNPMMNMMNNDCCC97NWRQLMKN98789889*BcECCCH-EHDHLGFTSQBFPEJFBBCanxSTo*nolDXM 3366hfI-RIB8QWVICKFBHJHPBRFHHBFCENMLCIEGGFFA98JHMOPLYPDFM7EIFIFBBABA66B8DD89C4CDCA99BC78-JPDCLGHB9BDE7DNNNAObjxTeVsciJECAEYLur9yD**o3qVmHJH9gDKtW9OCEBdC9*FeXTrNr*PsRhB*al*akePCGHD*HLGCMybk*F**OPxo*uM ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 207-216| PSIPRED ccEEEEEEEEEEEccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEEEEccccc //