[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54958.1
DDBJ      :             type I restriction-modification system, M subunit, putative
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  380/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:497 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->400 2okcA PDBj 5e-27 36.1 %
:RPS:PDB   153->497 2ar0B PDBj 9e-23 22.9 %
:RPS:SCOP  114->497 2ar0A1  c.66.1.45 * 2e-19 23.3 %
:HMM:SCOP  4->498 2ar0A1 c.66.1.45 * 7.1e-117 37.9 %
:RPS:PFM   154->414 PF02384 * N6_Mtase 7e-43 41.9 %
:HMM:PFM   152->464 PF02384 * N6_Mtase 5.1e-73 34.8 296/311  
:HMM:PFM   6->131 PF12161 * HsdM_N 4.8e-16 23.5 119/132  
:BLT:SWISS 2->455 T1ME_ECOLX 7e-37 28.8 %
:PROS 282->288|PS00092|N6_MTASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54958.1 GT:GENE ACF54958.1 GT:PRODUCT type I restriction-modification system, M subunit, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 785229..786722 GB:FROM 785229 GB:TO 786722 GB:DIRECTION + GB:PRODUCT type I restriction-modification system, M subunit, putative GB:NOTE identified by similarity to GB:AAK99594.1; match to protein family HMM PF02384 GB:PROTEIN_ID ACF54958.1 GB:DB_XREF GI:194356510 LENGTH 497 SQ:AASEQ MITGELKNKIDQLWEILWTEGNANPLTNIEQLTYLLFMKDLDSVELGRESDAEFLGIPYEGVFPKDKPEXRWSTFKNIGDAQEVYRLMTQEIFPFIKNLKGDTDDTAFSRYMREAIFQINKPATLQKAISILDVFPTRGLDVDFDNDKQSITDIGDIYEYLLSKLSTAGKNGQFRTPRHIIDMMVELMQPTIKDIISDPAMGSAGFLVSASRYLKRKKDEWETNTDNINHFHNQMFRGNDTDTTMLRLGAMNMMLHGVENPQISYLDSLSQDNEEADKYTLVLANPPFKGSLDYNSTSNDLLATVKTKKTELLFLSLFLRTLKPGGRAAVIVPDGVLFGSSKAHKGIRQEIVENHKLDAVISMPSGVFKPYAGVSTAILIFTKTGNGGTDKVWFYDMKADGLSLDDKRQPISDNDIPDIIERFHHLEKEAERQRTDQSFFVPVAEIKENDYDLSINKYKEIEYEKVEYEPTEVILKKINDLEKEIQAGLAELEKLLK GT:EXON 1|1-497:0| BL:SWS:NREP 1 BL:SWS:REP 2->455|T1ME_ECOLX|7e-37|28.8|431/490| PROS 282->288|PS00092|N6_MTASE|PDOC00087| SEG 306->323|ktkktellflslflrtlk| SEG 457->469|kykeieyekveye| BL:PDB:NREP 1 BL:PDB:REP 29->400|2okcA|5e-27|36.1|310/413| RP:PDB:NREP 1 RP:PDB:REP 153->497|2ar0B|9e-23|22.9|336/474| RP:PFM:NREP 1 RP:PFM:REP 154->414|PF02384|7e-43|41.9|248/273|N6_Mtase| HM:PFM:NREP 2 HM:PFM:REP 152->464|PF02384|5.1e-73|34.8|296/311|N6_Mtase| HM:PFM:REP 6->131|PF12161|4.8e-16|23.5|119/132|HsdM_N| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF02384|IPR003356| GO:PFM GO:0006306|"GO:DNA methylation"|PF02384|IPR003356| GO:PFM GO:0008170|"GO:N-methyltransferase activity"|PF02384|IPR003356| RP:SCP:NREP 1 RP:SCP:REP 114->497|2ar0A1|2e-19|23.3|378/485|c.66.1.45| HM:SCP:REP 4->498|2ar0A1|7.1e-117|37.9|462/0|c.66.1.45|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 569 OP:NHOMOORG 403 OP:PATTERN ----1--------1---------------1---1112--211-12-11-3226-1-----11-----2 -1---112---1-4-1-11-12--1--1----11-12-1--212-1--1----111--------------------111--2-------311--1-------221---1----------------1-3132--1---11-21--3-3-41114----------11--2421---------------------11-----11----1-----22-----121----1-1--1-1-----------------111---11---12---22-2---1--11--1-----1-1222222222221111111111111-22111222--1---111-21--1-1---1-1-----11122---2--2221---111--1151--2-------1---2--1-1-1111111111------------1-------12-----2-11----11-12111111111---1------------------12-12---11---------------1-----------------1----11--1--1-211--3----3-1--4--11--1111--14--2-1--27---3-1311--11-4--321-1-1-11---11-1111---1-------11-1-22-1223-------21-511-4-11-2--3-1---31---------1-21-1111111112--1-----2-11111111111---1111-11111-2122--1-1--11-1-1-------1-----1--------------1111111111--21213121----11-12112--1--1--11-1-22--21-1-21-111211---4-31114-1-1-11112-------1--1111--------1-1-1-2------1-----1-1-----11-1--------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 464 STR:RPRED 93.4 SQ:SECSTR ############################HHHHHHHHHHHHHHHHHTcccc#cccTTccHHHHHTcccHHH####HHHHHcTTcHHHHHHHHHHHHHHHHTcHHHHccTTccHHHHHTccHHHHHHHHHHHHHHHHTccccHHHHHHHTTccccccccHHHHHHHHHHHTccccccccHHHHHHHHHHHcccTTccEEETTcTTTHHHHHHHHHHHTTTTTTTccHHHHHHHHHTcEEEEEccHHHHHHHHHHHTTTccccGcEEEccTTcHHHHTcccEEEEEEccccTTccccccccccccccccccccHHHHHHHHHHHEEEEEEEEEEEEHHHHHccccTHHHHHHHHHHHEEEEEEEEcccccccccccccEEEEEEEEcccccccEEEEEEccTTcEEcccccccccGGGTHHHHHHHccTTcccccccccccTTcTTcEEcccGGGTTcccEEEEEHHHHHHTcccccccccEEcccccHHHHHHHHHHHH DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHcccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccEEEccHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHccccccHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccccccEEEcccccccccccccccEEEEcHHHcccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEcccEEccccccHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEEcccccccccEEEEEcccccEEcccccccccHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //