[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54959.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->66 PF10975 * DUF2802 0.0006 25.9 58/70  
:BLT:SWISS 57->104 KTU_DROWI 2e-04 39.6 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54959.1 GT:GENE ACF54959.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 924188..924502 GB:FROM 924188 GB:TO 924502 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54959.1 GB:DB_XREF GI:194356511 LENGTH 104 SQ:AASEQ MASKRLSIEEQIEKKEESIKQLQNQKRQLKKKLNEQERKARNKRLIEKGAVFESIFEESIDLTKDEFYKLIKTXNDEEIRLNIMEILEERIDDNVEKSSKDEIT GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 57->104|KTU_DROWI|2e-04|39.6|48/1204| COIL:NAA 43 COIL:NSEG 1 COIL:REGION 2->44| SEG 6->37|lsieeqiekkeesikqlqnqkrqlkkklneqe| HM:PFM:NREP 1 HM:PFM:REP 8->66|PF10975|0.0006|25.9|58/70|DUF2802| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-44,95-105| PSIPRED ccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //