[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54961.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->54 PF01104 * Bunya_NS-S 0.00059 33.3 24/91  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54961.1 GT:GENE ACF54961.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1124493..1124666) GB:FROM 1124493 GB:TO 1124666 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54961.1 GB:DB_XREF GI:194356513 LENGTH 57 SQ:AASEQ MTDVRGTSCFVIKFGKAGEQLAAKLWEEGKMVYASSASMIKRLKLAMRARCNGVYGR GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 31->54|PF01104|0.00059|33.3|24/91|Bunya_NS-S| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111-1-11--------------111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,57-58| PSIPRED cccccccEEEEEEEcccHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccccc //