[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54972.1
DDBJ      :             transcriptional regulator, point mutation
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->70 2ethA PDBj 8e-06 35.4 %
:RPS:PDB   4->99 2a61A PDBj 6e-07 20.8 %
:RPS:SCOP  4->65 2bv6A1  a.4.5.28 * 5e-10 30.6 %
:HMM:SCOP  2->94 2fbkA1 a.4.5.28 * 6.7e-18 29.0 %
:HMM:PFM   4->42 PF01047 * MarR 3.7e-08 25.6 39/59  
:HMM:PFM   59->91 PF06331 * Tbf5 0.00053 33.3 33/68  
:BLT:SWISS 4->69 TCAR_STAAE 9e-06 30.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54972.1 GT:GENE ACF54972.1 GT:PRODUCT transcriptional regulator, point mutation GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1747651..1747950) GB:FROM 1747651 GB:TO 1747950 GB:DIRECTION - GB:PRODUCT transcriptional regulator, point mutation GB:PROTEIN_ID ACF54972.1 GB:DB_XREF GI:194356524 LENGTH 99 SQ:AASEQ MVLIKDIEQELNITKSVASNLVKRIVQNGLVELEASPVDKRAKFVRLTDKARSQMQQVKAFFERIDKQLMEDIDEDELLIFEKVLGQLQAKYQGNRRRE GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 4->69|TCAR_STAAE|9e-06|30.3|66/151| SEG 71->80|edidedelli| BL:PDB:NREP 1 BL:PDB:REP 5->70|2ethA|8e-06|35.4|65/135| RP:PDB:NREP 1 RP:PDB:REP 4->99|2a61A|6e-07|20.8|96/142| HM:PFM:NREP 2 HM:PFM:REP 4->42|PF01047|3.7e-08|25.6|39/59|MarR| HM:PFM:REP 59->91|PF06331|0.00053|33.3|33/68|Tbf5| RP:SCP:NREP 1 RP:SCP:REP 4->65|2bv6A1|5e-10|30.6|62/136|a.4.5.28| HM:SCP:REP 2->94|2fbkA1|6.7e-18|29.0|93/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 37 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111--11-111111---11111111111-1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 99.0 SQ:SECSTR #EEHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcc DISOP:02AL 92-100| PSIPRED ccHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc //