[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54973.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->166 PF06912 * DUF1275 3e-13 32.7 %
:HMM:PFM   19->219 PF06912 * DUF1275 1.6e-45 31.0 200/209  
:BLT:SWISS 20->85 YOAK_BACSU 8e-05 30.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54973.1 GT:GENE ACF54973.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 981560..982258 GB:FROM 981560 GB:TO 982258 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06912 GB:PROTEIN_ID ACF54973.1 GB:DB_XREF GI:194356525 LENGTH 232 SQ:AASEQ MGGKMRLXPIRKISRQSKRLALFLTFCAGYVDAYTFIVRGNTLVAGQTGNVVFLSVELIKNNVSDVRDKVLTLLAFMMGVFLLTIYKEKLRIVKKPILSLIPLAILSIIIAFVPQTVDNIYLVPPLAFCMGLVTTAFGEVSGIAYNNAFMTGNIKRTMLAFGDYFRTKHTPFLREGFIFVSLLSSFVLGVVFSAYLTIFYHEKTILGVPIMMSVFYLSMLFASWQKKVKEKA GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 20->85|YOAK_BACSU|8e-05|30.3|66/100| TM:NTM 6 TM:REGION 21->43| TM:REGION 58->80| TM:REGION 96->118| TM:REGION 121->143| TM:REGION 174->196| TM:REGION 204->225| SEG 96->111|pilsliplailsiiia| SEG 176->193|gfifvsllssfvlgvvfs| RP:PFM:NREP 1 RP:PFM:REP 20->166|PF06912|3e-13|32.7|147/210|DUF1275| HM:PFM:NREP 1 HM:PFM:REP 19->219|PF06912|1.6e-45|31.0|200/209|DUF1275| OP:NHOMO 49 OP:NHOMOORG 49 OP:PATTERN ----------------------------------------------------1--------------- --------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1111111--1-----1-1---1---11-1111111111-111111111111-1--------1----1-------1-1-1----------1---------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11,230-233| PSIPRED ccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //