[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54976.1
DDBJ      :             CrcB protein
Swiss-Prot:CRCB2_STRR6  RecName: Full=Protein crcB homolog 2;

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->118 PF02537 * CRCB 5.7e-31 47.7 109/117  
:BLT:SWISS 1->124 CRCB2_STRR6 3e-51 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54976.1 GT:GENE ACF54976.1 GT:PRODUCT CrcB protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1162269..1162643) GB:FROM 1162269 GB:TO 1162643 GB:DIRECTION - GB:PRODUCT CrcB protein GB:NOTE identified by match to protein family HMM PF02537 GB:PROTEIN_ID ACF54976.1 GB:DB_XREF GI:194356528 LENGTH 124 SQ:AASEQ MKKEQFYPLGIFLAAMLGGLVRYLVSTWLPASPDFPWGTLFVNYLGIFCLIFLVKGYLVYKGTSKGLILALGTGFCGGLTTFSSLMLDTVKLLDTGRYFSLVLYLLLSIGGGLLLAYFLGRKKW GT:EXON 1|1-124:0| SW:ID CRCB2_STRR6 SW:DE RecName: Full=Protein crcB homolog 2; SW:GN Name=crcB2; OrderedLocusNames=spr1173; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|CRCB2_STRR6|3e-51|100.0|124/124| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 8->30| TM:REGION 37->59| TM:REGION 67->89| TM:REGION 98->120| SEG 71->82|lgtgfcgglttf| SEG 101->115|lvlylllsiggglll| HM:PFM:NREP 1 HM:PFM:REP 10->118|PF02537|5.7e-31|47.7|109/117|CRCB| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111111111-------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccc //