[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54982.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->43 PF11391 * DUF2798 0.00011 26.9 26/60  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54982.1 GT:GENE ACF54982.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(685613..685804) GB:FROM 685613 GB:TO 685804 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF54982.1 GB:DB_XREF GI:194356534 LENGTH 63 SQ:AASEQ MSFYGLFYNGIAITPNTYLSAWFVNFIAALPLNFLIVEPIARFILSSFQKPFTGEEVEEVEDF GT:EXON 1|1-63:0| TM:NTM 1 TM:REGION 22->44| HM:PFM:NREP 1 HM:PFM:REP 17->43|PF11391|0.00011|26.9|26/60|DUF2798| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,57-57,60-64| PSIPRED ccHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcc //