[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54989.1
DDBJ      :             transcriptional regulator, PadR family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->100 1xmaA PDBj 2e-13 38.9 %
:RPS:PDB   11->88 2e1nA PDBj 3e-08 30.8 %
:RPS:SCOP  10->100 1yg2A  a.4.5.61 * 3e-10 21.7 %
:HMM:SCOP  3->100 1xmaA_ a.4.5.61 * 6.2e-19 34.7 %
:RPS:PFM   9->81 PF03551 * PadR 1e-07 39.7 %
:HMM:PFM   8->81 PF03551 * PadR 1.2e-21 40.5 74/86  
:BLT:SWISS 10->101 YX_BACSH 3e-11 39.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54989.1 GT:GENE ACF54989.1 GT:PRODUCT transcriptional regulator, PadR family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(98792..99118) GB:FROM 98792 GB:TO 99118 GB:DIRECTION - GB:PRODUCT transcriptional regulator, PadR family GB:NOTE identified by match to protein family HMM PF03551 GB:PROTEIN_ID ACF54989.1 GB:DB_XREF GI:194356541 LENGTH 108 SQ:AASEQ MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIRHDKN GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 10->101|YX_BACSH|3e-11|39.1|92/109| BL:PDB:NREP 1 BL:PDB:REP 10->100|1xmaA|2e-13|38.9|90/101| RP:PDB:NREP 1 RP:PDB:REP 11->88|2e1nA|3e-08|30.8|78/110| RP:PFM:NREP 1 RP:PFM:REP 9->81|PF03551|1e-07|39.7|73/84|PadR| HM:PFM:NREP 1 HM:PFM:REP 8->81|PF03551|1.2e-21|40.5|74/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 10->100|1yg2A|3e-10|21.7|83/169|a.4.5.61| HM:SCP:REP 3->100|1xmaA_|6.2e-19|34.7|98/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 227 OP:NHOMOORG 154 OP:PATTERN -------------------------------------------1---1---1---------------- -21-------------------------------------------1-------------1--1----------------1-----------------------------------------------------------------------------------------------------------------333333531543442--111-324--121-211111121---------------121--2-1-11---1-1111--11112-111111211111111111111111111111111111112222-2221--2112221221-3-2222-11-2-2-1-11--22-------1----------2111---------1-----------------------------1--1--1---1----------------------------11----------------------------------------------------1111----111111------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-2-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 88.0 SQ:SECSTR #####cHHHHHHHHHHHHTTccEEHHHHHHHHHHHcEccHHHHHHHHHHHHHTTcEEEEEEcTccccEEEEEEccccHHHHHHHHHHHHHHHHHTTTTcc######## DISOP:02AL 1-2,4-4,61-64,99-109| PSIPRED ccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //