[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54990.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  737/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.258.1c.37.1
:147 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->132 1htwA PDBj 3e-14 32.3 %
:RPS:PDB   6->53 3czpB PDBj 7e-06 22.9 %
:RPS:PDB   25->126 2afkH PDBj 7e-04 13.7 %
:RPS:SCOP  7->104 2aplA1  a.258.1.1 * 1e-09 14.3 %
:HMM:SCOP  20->145 1htwA_ c.37.1.18 * 3.8e-19 31.7 %
:RPS:PFM   10->127 PF02367 * UPF0079 7e-26 54.2 %
:HMM:PFM   11->126 PF02367 * UPF0079 9.2e-36 44.8 116/123  
:BLT:SWISS 3->143 YDIB_BACSU 4e-33 47.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54990.1 GT:GENE ACF54990.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1765420..1765863) GB:FROM 1765420 GB:TO 1765863 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02367; match to protein family HMM TIGR00150 GB:PROTEIN_ID ACF54990.1 GB:DB_XREF GI:194356542 LENGTH 147 SQ:AASEQ MYTKNEEELQALGERLGHLLAKNDVLILIGELGAGKTTFTKGLAKGLQISQMIKSPTYTIVREYEGRLPLYHLDVYRIEGDADSIDLDEFIFGGGVTVIEWGNLLGDALPDAYLELEILKEADGRRLNFQAKGLRAEKLLEELQYGV GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 3->143|YDIB_BACSU|4e-33|47.5|141/158| BL:PDB:NREP 1 BL:PDB:REP 2->132|1htwA|3e-14|32.3|130/158| RP:PDB:NREP 2 RP:PDB:REP 6->53|3czpB|7e-06|22.9|48/452| RP:PDB:REP 25->126|2afkH|7e-04|13.7|102/262| RP:PFM:NREP 1 RP:PFM:REP 10->127|PF02367|7e-26|54.2|118/123|UPF0079| HM:PFM:NREP 1 HM:PFM:REP 11->126|PF02367|9.2e-36|44.8|116/123|UPF0079| RP:SCP:NREP 1 RP:SCP:REP 7->104|2aplA1|1e-09|14.3|98/149|a.258.1.1| HM:SCP:REP 20->145|1htwA_|3.8e-19|31.7|126/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 743 OP:NHOMOORG 740 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-111111111111----111111111--1111-1-111111--11-1----1111111-111111-111111111111--11111111111--------------111-111111111111111111111111111111111-111-111111111111111-111--11111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111------1------11--111-111----1---------11-11111111111111-1111---1--11111111111-11-111111-11111---1-1111111-1--1-----1111111111111111111111111111111111-----1----1--1-1-11-111-111111111111111111-111111111-11--11111111111111-11-1-1------1--------------11111111111111111111111111111111----1-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111-11111111111111111----1111-11-111---11---1-1------1--11---1-111111-1111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 98.0 SQ:SECSTR #EEccHHHHHHHHHHHHHHHHccEEEEEEEcTTccHHHHHHHHHHHcGGGEEEEEcccHHHHHTTccccHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTHHHHHHHGGGEEEEcccccccEEEEEEccHHHHHTHHHHHHH## PSIPRED cccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccEEEEEEEcccccEEEEEEEEcccHHHHcccHHHcccccEEEEEcHHHHHccccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHcc //