[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54991.1
DDBJ      :             PTS system,  IIB component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->77 3czcA PDBj 7e-09 26.0 %
:RPS:SCOP  1->73 1vkrA  c.44.2.1 * 1e-04 27.9 %
:HMM:SCOP  1->101 1vkrA_ c.44.2.1 * 1.8e-11 25.5 %
:HMM:PFM   3->55 PF02302 * PTS_IIB 2.6e-11 26.9 52/90  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54991.1 GT:GENE ACF54991.1 GT:PRODUCT PTS system, IIB component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1068777..1069079) GB:FROM 1068777 GB:TO 1069079 GB:DIRECTION - GB:PRODUCT PTS system, IIB component GB:PROTEIN_ID ACF54991.1 GB:DB_XREF GI:194356543 LENGTH 100 SQ:AASEQ MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNEDLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSVPVFDNIRLPAKQNMV GT:EXON 1|1-100:0| RP:PDB:NREP 1 RP:PDB:REP 1->77|3czcA|7e-09|26.0|73/89| HM:PFM:NREP 1 HM:PFM:REP 3->55|PF02302|2.6e-11|26.9|52/90|PTS_IIB| RP:SCP:NREP 1 RP:SCP:REP 1->73|1vkrA|1e-04|27.9|68/97|c.44.2.1| HM:SCP:REP 1->101|1vkrA_|1.8e-11|25.5|94/0|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 46 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--1-------1---------1111---1--222222212221111111111111---------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 73.0 SQ:SECSTR cEEEEEEccccHHHHHH###HHHHHHHHTTccEEEEEEcHHHH#HHHGGGccEEETTTGGGTTTccccEEEEEccTc####################### DISOP:02AL 99-101| PSIPRED ccEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEEEEHHHHHHHccccEEEEEHHHcccccccccEEEcccEEEEccccccHHHHHHHHHHHHHcc //