[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF54995.1
DDBJ      :             Tn5251 hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->107 2k5dA PDBj 7e-58 100.0 %
:RPS:PFM   3->105 PF06125 * DUF961 4e-23 58.4 %
:HMM:PFM   4->106 PF06125 * DUF961 4.8e-46 59.2 103/105  
:BLT:SWISS 5->111 YDCP_BACSU 4e-13 41.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54995.1 GT:GENE ACF54995.1 GT:PRODUCT Tn5251 hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1208244..1208627) GB:FROM 1208244 GB:TO 1208627 GB:DIRECTION - GB:PRODUCT Tn5251 hypothetical protein GB:NOTE identified by match to protein family HMM PF06125 GB:PROTEIN_ID ACF54995.1 GB:DB_XREF GI:194356547 LENGTH 127 SQ:AASEQ MRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 5->111|YDCP_BACSU|4e-13|41.9|105/100| BL:PDB:NREP 1 BL:PDB:REP 1->107|2k5dA|7e-58|100.0|107/110| RP:PFM:NREP 1 RP:PFM:REP 3->105|PF06125|4e-23|58.4|101/101|DUF961| HM:PFM:NREP 1 HM:PFM:REP 4->106|PF06125|4.8e-46|59.2|103/105|DUF961| OP:NHOMO 25 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------1-------------1-----1----------1-------2-------------------------1------------211-11-1--------------11---2-1------------1----4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 84.3 SQ:SECSTR cccccccccccGGGcccEEEEEEEEEEEEEcTTccEEEEEEEEEEEEEccccccEEEEEEETTcccccccTTcEEEEcccEEcccHHHHccccccccEEEcccEEEc#################### DISOP:02AL 1-1,108-128| PSIPRED cccccEEEEcHHHccccccEEEEccEEEEEccccccccEEEEEEEEccccccccEEEEEEccccccccccccccEEEEccEEEEEEEEEEcccEEEEEEEEEEEEEEcccccccccHHHcccccccc //