[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55005.1
DDBJ      :             acetyltransferase, GNAT family protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  148/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->152 1nslF PDBj 3e-08 31.9 %
:RPS:PDB   15->183 3eg7B PDBj 4e-14 14.3 %
:RPS:SCOP  14->154 2fckA1  d.108.1.1 * 2e-29 22.9 %
:HMM:SCOP  7->178 2fckA1 d.108.1.1 * 2.2e-40 29.7 %
:HMM:PFM   76->152 PF00583 * Acetyltransf_1 3e-08 15.8 76/83  
:BLT:SWISS 9->152 YOAA_BACSU 2e-15 30.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55005.1 GT:GENE ACF55005.1 GT:PRODUCT acetyltransferase, GNAT family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 965090..965641 GB:FROM 965090 GB:TO 965641 GB:DIRECTION + GB:PRODUCT acetyltransferase, GNAT family protein GB:NOTE identified by match to protein family HMM PF00583 GB:PROTEIN_ID ACF55005.1 GB:DB_XREF GI:194356557 LENGTH 183 SQ:AASEQ MNIWTKLAMFSFFETDRLYLRPFFFSDSQDFREIASNPENLQFIFPTQASLEESQYALANYFMKSPLGVWAICDQKNQQMIGSIKFEKLDEIKKEAELGYFLRKDAWSQGFMTEVVRKICQLSFEEFGLKQLFIITHLENKASQRVALKSGFSLFRQFKGSDRYTRKMRDYLEFRYVKGEFNE GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 9->152|YOAA_BACSU|2e-15|30.6|144/177| BL:PDB:NREP 1 BL:PDB:REP 84->152|1nslF|3e-08|31.9|69/174| RP:PDB:NREP 1 RP:PDB:REP 15->183|3eg7B|4e-14|14.3|168/172| HM:PFM:NREP 1 HM:PFM:REP 76->152|PF00583|3e-08|15.8|76/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 14->154|2fckA1|2e-29|22.9|140/174|d.108.1.1| HM:SCP:REP 7->178|2fckA1|2.2e-40|29.7|172/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 266 OP:NHOMOORG 155 OP:PATTERN ---------------------------------------------1------1-----11-------- ----1--------------------1--------------------1-----------------111---1-------1-1-1-------11-1------111----1-1----------------------------------1-1-1---1-------------1-111-----------------------33333344-4333341311-1343--14122------111-------------------1-----2--------11--111-22232313334113444444444411111111111114221112221-11-1--------1--111111-1-1----1------------1-2--1---1----------------1-----------------------------3---------------1-----------------------------------------------------------------------1-----------------------------------------------------------------------11-------------------------------1------------------2---1------------------------------------11-----------------------------------------------------------------------------------------2-1--1-------------------------1--------1-----1---------------------------1-----------------------------------1------------------1--------------1---- --------------------------1-------------------------1-----------------------------------------------------------------------------------------------------------------------------------------3-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 94.0 SQ:SECSTR ###########cETHHTcEEEEccGGGHHHHHHHTTTTccEEETTEEEccHHHHHHHHHHHTTccccEEEEEEcTTTccEEEEEEEEEEETTTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTccccEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHHHHHHT DISOP:02AL 1-1,182-184| PSIPRED cccEEEEEEccEEEccEEEEEEccHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccEEEEEEEccEEEccEEEEEEEEEEcHHHccc //