[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55010.1
DDBJ      :             ABC transporter,  permease protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  177/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.37.1
:142 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   62->112 3b60A PDBj 4e-09 25.5 %
:RPS:SCOP  2->134 2hydA2  f.37.1.1 * 4e-10 20.3 %
:HMM:SCOP  1->134 1pf4A2 f.37.1.1 * 1.2e-19 24.8 %
:HMM:PFM   2->127 PF00664 * ABC_membrane 3.5e-11 21.0 124/275  
:BLT:SWISS 1->133 Y1304_MYCBO 4e-14 31.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55010.1 GT:GENE ACF55010.1 GT:PRODUCT ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1747184..1747612) GB:FROM 1747184 GB:TO 1747612 GB:DIRECTION - GB:PRODUCT ABC transporter, permease protein GB:PROTEIN_ID ACF55010.1 GB:DB_XREF GI:194356562 LENGTH 142 SQ:AASEQ MILLAILFTCFSVYLELEVPTYISKITDLLGSQETNLDELWQPASMMMGMLFLAFLSVVAVGFFASRVAASYTSRLRSDIFNRVLDYSQTEIKKFSIPSLLTRTTNDITQVQMLITMGLQVVTRGPIMAIWAIGKILGHSEY GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 1->133|Y1304_MYCBO|4e-14|31.2|128/582| TM:NTM 2 TM:REGION 1->23| TM:REGION 47->69| RP:PDB:NREP 1 RP:PDB:REP 62->112|3b60A|4e-09|25.5|51/572| HM:PFM:NREP 1 HM:PFM:REP 2->127|PF00664|3.5e-11|21.0|124/275|ABC_membrane| RP:SCP:NREP 1 RP:SCP:REP 2->134|2hydA2|4e-10|20.3|133/323|f.37.1.1| HM:SCP:REP 1->134|1pf4A2|1.2e-19|24.8|133/311|f.37.1.1|1/1|ABC transporter transmembrane region| OP:NHOMO 223 OP:NHOMOORG 179 OP:PATTERN ---------------------------------------------------1---------------- ----11--111---11111-11111-1111111111--11--11-12-1--12221-2--1111---111-11112222-11-----------------------------------------------------------111--------------------------------------------11-1-1-----1------11--11111--1-111--121112211--------------------4-111111---221111211-12-11-11----21111-11-111---------------21122211112112211111112113322111131111-31--321----1--11121-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------2------1-11112111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 35.9 SQ:SECSTR #############################################################HHHHHHHHHHHHHHHHHHHHHHHHTcccTHHHHccHHHHHHHHHHHHHHHH############################## PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //