[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55016.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->95 PF09683 * Lactococcin_972 3e-04 53.3 %
:HMM:PFM   32->95 PF09683 * Lactococcin_972 6.4e-22 54.8 62/64  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55016.1 GT:GENE ACF55016.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1803077..1803373) GB:FROM 1803077 GB:TO 1803373 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF55016.1 GB:DB_XREF GI:194356568 LENGTH 98 SQ:AASEQ MKQTVKKLALVASIAATLGGSVAVASAVVQYPEGGVWTYGSGNGGAYSNYYHPSKYHSSTVVSRKTGSSDKGYAGAGGTSRAWIRTSWGEKVAFYYNV GT:EXON 1|1-98:0| TM:NTM 1 TM:REGION 8->30| SEG 21->29|svavasavv| SEG 39->51|ygsgnggaysnyy| RP:PFM:NREP 1 RP:PFM:REP 33->95|PF09683|3e-04|53.3|60/61|Lactococcin_972| HM:PFM:NREP 1 HM:PFM:REP 32->95|PF09683|6.4e-22|54.8|62/64|Lactococcin_972| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112221111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHEEEHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEEccEEEEccccccEEEEEEEEEccccccccccccccEEEEEccccccccEEEEEEc //