[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55019.1
DDBJ      :             histidine kinase TCS03
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  526/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:331 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   137->326 3gigA PDBj 9e-12 29.1 %
:RPS:PDB   137->321 3ehjA PDBj 1e-18 22.7 %
:RPS:SCOP  197->327 1id0A  d.122.1.3 * 3e-10 14.8 %
:HMM:SCOP  191->333 1gkzA2 d.122.1.4 * 1.2e-17 21.7 %
:RPS:PFM   243->327 PF02518 * HATPase_c 7e-04 31.8 %
:HMM:PFM   132->200 PF07730 * HisKA_3 2.9e-18 39.7 68/68  
:HMM:PFM   238->327 PF02518 * HATPase_c 1.7e-12 28.9 90/111  
:BLT:SWISS 137->327 VRAS_STAS1 1e-37 40.4 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55019.1 GT:GENE ACF55019.1 GT:PRODUCT histidine kinase TCS03 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 345841..346836 GB:FROM 345841 GB:TO 346836 GB:DIRECTION + GB:PRODUCT histidine kinase TCS03 GB:NOTE identified by match to protein family HMM PF02518; match to protein family HMM PF07730 GB:PROTEIN_ID ACF55019.1 GB:DB_XREF GI:194356571 LENGTH 331 SQ:AASEQ MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKFVFLLLVFSMSMTCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVVDPDLDASFKSLSGKLNLLTEALQKAENHSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQALKLDREKMQTQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDLRVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGIGFQLGSLDDLSYGLRNIKDRVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE GT:EXON 1|1-331:0| BL:SWS:NREP 1 BL:SWS:REP 137->327|VRAS_STAS1|1e-37|40.4|188/347| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 161->189| TM:NTM 2 TM:REGION 7->29| TM:REGION 44->66| SEG 13->25|sflfvfffshsll| SEG 125->136|eeeiiekerkri| BL:PDB:NREP 1 BL:PDB:REP 137->326|3gigA|9e-12|29.1|175/212| RP:PDB:NREP 1 RP:PDB:REP 137->321|3ehjA|1e-18|22.7|172/196| RP:PFM:NREP 1 RP:PFM:REP 243->327|PF02518|7e-04|31.8|85/112|HATPase_c| HM:PFM:NREP 2 HM:PFM:REP 132->200|PF07730|2.9e-18|39.7|68/68|HisKA_3| HM:PFM:REP 238->327|PF02518|1.7e-12|28.9|90/111|HATPase_c| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 197->327|1id0A|3e-10|14.8|128/146|d.122.1.3| HM:SCP:REP 191->333|1gkzA2|1.2e-17|21.7|143/193|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 1127 OP:NHOMOORG 528 OP:PATTERN -------------------------------------------------------------------- 258-11111111-112211-12--2411111-41-11384-11-111--1111131----12411312231--------2--1-----11---------2-511183612-------------------1------7AA99344C13--2--------------1-1225-------------34121--1245334345674744668546546686233852211111178333333333333333333421---11-1--111-11111--1-111111121232222222222222111111111111131111-1112-214-1111121-1-1-------1-1--7-11-53-21124-11-1----21----------12--1--12-23111-111-1-11-22-24-311-1-1111---1-111-----1------111------------11--------------------------------------11-142232231111336A3333143261342--56256333234622341363511---1-11111424-121--11-21----3-3-142-311111-24---------------------------11-11-2111-12222--212211132124-----11------2113-111221111111-211111111121111111111111222222121222122221211111111--111111-11111---2---------1-3-1111--1----------------1--1-22222423333321222----------121222222232332211111112----1-1-----11-----------------------------------------------A- -------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 65.3 SQ:SECSTR ###############################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHHccccccHHHHHHHHHTTcEEcccccccccccHHHHHHHHHHHHHHHHHHHHTcccEEEEEEEEcccEEEEEEEEcccccccccccTTcccHHHHHHHHHHTTcEEEEEccccEEEEEEEEEEc#### DISOP:02AL 1-3,121-122,124-129,164-167,330-332| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccEEEEEEEEccccccccccccccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEEccccc //