[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55022.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:243 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   17->48 2r6fB PDBj 3e-04 43.8 %
:BLT:PDB   36->223 1vplA PDBj 2e-26 33.0 %
:RPS:PDB   2->218 3cmvH PDBj 1e-38 9.7 %
:RPS:SCOP  1->221 1b0uA  c.37.1.12 * 9e-36 25.8 %
:HMM:SCOP  1->236 1g6hA_ c.37.1.12 * 9.2e-57 34.7 %
:RPS:PFM   41->159 PF00005 * ABC_tran 1e-10 35.7 %
:HMM:PFM   41->160 PF00005 * ABC_tran 1.7e-20 35.4 113/118  
:HMM:PFM   17->51 PF03308 * ArgK 0.00011 37.1 35/267  
:HMM:PFM   215->233 PF10945 * DUF2629 0.00032 47.4 19/44  
:BLT:SWISS 1->241 ECSA_BACSU 3e-80 57.7 %
:PROS 133->147|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55022.1 GT:GENE ACF55022.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 467311..468042 GB:FROM 467311 GB:TO 468042 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005 GB:PROTEIN_ID ACF55022.1 GB:DB_XREF GI:194356574 LENGTH 243 SQ:AASEQ MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTINEIIGLLTPYSGSININGLTLQEDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGIEQKVTFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGLDPLAISDLIQLLEVEKQKGKSILMSTHVLDSAXXMCDAFVILHKGEVRAKGNLLQLREAFDMPEASLNDIYLALTKEEDL GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 1->241|ECSA_BACSU|3e-80|57.7|241/247| PROS 133->147|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 2 BL:PDB:REP 17->48|2r6fB|3e-04|43.8|32/864| BL:PDB:REP 36->223|1vplA|2e-26|33.0|188/238| RP:PDB:NREP 1 RP:PDB:REP 2->218|3cmvH|1e-38|9.7|216/1173| RP:PFM:NREP 1 RP:PFM:REP 41->159|PF00005|1e-10|35.7|112/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 41->160|PF00005|1.7e-20|35.4|113/118|ABC_tran| HM:PFM:REP 17->51|PF03308|0.00011|37.1|35/267|ArgK| HM:PFM:REP 215->233|PF10945|0.00032|47.4|19/44|DUF2629| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->221|1b0uA|9e-36|25.8|221/258|c.37.1.12| HM:SCP:REP 1->236|1g6hA_|9.2e-57|34.7|236/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 46354 OP:NHOMOORG 1172 OP:PATTERN UTPASLGKSTSQUOZPmMRQMQOawLPglWgUHDDCDCHGGEBUbOVjNQ**g8QhOUbKPJLEY178 TVvL*dbZihkSaQUOOLK-Kb99U*LLLLLKpnnps***U*X*o*ucqXTLzzuOOUFHrt*a*rw***bXUTTyZWYNuZfCCDACPORK6ODGK--HHRMLLeNbRV69999998A9BBBBHSONPTPKRUWTkss**LKI*brjpyhgiegTVMEJHJFegZh***YFOFIHFGKFIGEdWXNLqj9Xi*************************kr***imy**xwz**coprprnloooooonZdabc*eed**cQaZg**QR**eVSYjfijlposuulywwxswsqnovxputbbcbZbbcebbabzrrhghtsusq*z*********l*nr***dikh*rjwu*isTH**qkabinVbkdtqQYbYObRPPJIIGGKfS***VQo****************-di*aV*h***NB**************HGK**********ONOOOOOOqTZKPhTw887776666667869A88988988997A6HDDBCF***********vwtvp*****y**g********AOwunyjomm******VkeJSIRbSEFFEFFEQOQYkhd**QaUulTgtZYpKeYZRSVhQZbbVapwa*KKLRFKIJLGFAAACBBCABMRDHENMoltOtVYJVJyMUWXVNScVTTTUVaaVZY6-CKTNO22-333*x**V*usxxwtxszqt-vssswswssrwytnorpno*****gibklijilkmkjijljji*nimppnpQ4************44GJGKGGIMOPPQK*i*ZZYaVVKPRMNTPUeMNPNNFPGMSnYpmpnq***s**wve***DEDACDDDEKgqp*pqqqq***yyPNNKMLLKLLGFFF65LRSRMNNM89788888*DUCC999-BEDAGD8999ADIAAA557gluYZo*qsmBfL 2232dVF-YF4ETcNGEEA9GKHNCMHCC799AMGE6DAAB9B777ECEGNIQHADF9DEGF77769825868ACBC1AA7A966D33-AG5EB55A656959HBB6NEfkNXRcViGHE8GSLnhCmD**c3cPgIHG9aEIlWDKGHFXED*FRRNmEX*GhMdEwZg*cccLACE5z988CFmXV*D*kEAkXcYL ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 242-244| PSIPRED cEEEEEEEEEEccEEEEEccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHccHHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHcccEEEEEEccEEEEEccHHHHHHHcccccccHHHHHHHHHHcccc //