[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55036.1
DDBJ      :             peptidase T
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  327/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.56.5d.15.6d.58.19
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->126 3ifeA PDBj 3e-35 55.5 %
:RPS:PDB   6->123 3d7gA PDBj 1e-12 8.5 %
:RPS:SCOP  8->63 1m4vA2  d.15.6.1 * 2e-11 17.9 %
:RPS:SCOP  47->127 1fnoA4  c.56.5.4 * 5e-28 44.4 %
:HMM:SCOP  8->46 1fnoA3 d.58.19.1 * 1.1e-05 53.8 %
:HMM:SCOP  48->128 1fnoA4 c.56.5.4 * 2.8e-17 35.8 %
:RPS:PFM   39->123 PF01546 * Peptidase_M20 3e-07 29.4 %
:HMM:PFM   59->124 PF01546 * Peptidase_M20 5e-09 25.8 66/171  
:HMM:PFM   8->57 PF11101 * DUF2884 0.00052 20.0 50/229  
:BLT:SWISS 8->131 PEPT_STRZT 1e-67 99.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55036.1 GT:GENE ACF55036.1 GT:PRODUCT peptidase T GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(900469..900864) GB:FROM 900469 GB:TO 900864 GB:DIRECTION - GB:PRODUCT peptidase T GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55036.1 GB:DB_XREF GI:194356588 LENGTH 131 SQ:AASEQ MQATSFXDFEKDAFEARKASMQSIADKMNEELGSDRVTLNLTDQYYNMKEVIEKDMTPITIAKTVMEDLGITPIIEPIRGGTDGSKISFMGIPTPNIFAGGENMHGRFEYVSLQTMERAVDTIIGIVAYKG GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 8->131|PEPT_STRZT|1e-67|99.2|124/407| BL:PDB:NREP 1 BL:PDB:REP 8->126|3ifeA|3e-35|55.5|119/416| RP:PDB:NREP 1 RP:PDB:REP 6->123|3d7gA|1e-12|8.5|118/691| RP:PFM:NREP 1 RP:PFM:REP 39->123|PF01546|3e-07|29.4|85/308|Peptidase_M20| HM:PFM:NREP 2 HM:PFM:REP 59->124|PF01546|5e-09|25.8|66/171|Peptidase_M20| HM:PFM:REP 8->57|PF11101|0.00052|20.0|50/229|DUF2884| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01546|IPR002933| GO:PFM GO:0016787|"GO:hydrolase activity"|PF01546|IPR002933| RP:SCP:NREP 2 RP:SCP:REP 8->63|1m4vA2|2e-11|17.9|56/104|d.15.6.1| RP:SCP:REP 47->127|1fnoA4|5e-28|44.4|81/295|c.56.5.4| HM:SCP:REP 8->46|1fnoA3|1.1e-05|53.8|39/113|d.58.19.1|1/1|Bacterial exopeptidase dimerisation domain| HM:SCP:REP 48->128|1fnoA4|2.8e-17|35.8|81/0|c.56.5.4|1/1|Zn-dependent exopeptidases| OP:NHOMO 366 OP:NHOMOORG 331 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2---------1111-111---1111111-1-1--------------------------------------------------------------------------------1--11111111111111111-1111111111111111111111111111111111111111112212-12122211111111111111111111111111111111111111111111111111111111111--1111111111111-1--11111--21111--11----1---111-111--1-----------11111111111----------1---1---------1--111111121-------------11------------------------------------------------------------------------------------------------------------1-------------1--------------------------------11------11----------------11----------------1----1-11-11--2----------12222211111111111-111121111111111111111122112111111111111111121111111--122222211222---------------------111-11111--1---------------------------------------22211111111111-----------------2--------------1-1-------------------------------------1 --------211--------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 94.7 SQ:SECSTR #####TTTcTTccHHHHHHHTcTTcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTTcHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcTTTTT## DISOP:02AL 1-2| PSIPRED cccEEEccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHccccHHHHHHHHHHHHcccccEEEEEccccHHHHHHHccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHcc //