[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55040.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  301/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
b.69.2b.70.2
:337 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->335 3hfqA PDBj 1e-86 48.5 %
:RPS:PDB   42->270 2dg0E PDBj 7e-04 9.4 %
:RPS:PDB   243->326 1c5kA PDBj 8e-06 20.7 %
:RPS:SCOP  145->298 1jmxB  b.69.2.2 * 5e-10 16.2 %
:HMM:SCOP  10->337 1qksA2 b.70.2.1 * 1.8e-37 25.9 %
:RPS:PFM   17->318 PF10282 * Muc_lac_enz 2e-58 44.0 %
:HMM:PFM   4->335 PF10282 * Muc_lac_enz 2.9e-116 46.7 332/345  
:BLT:SWISS 1->333 Y2431_LACLM 7e-97 53.5 %
:REPEAT 2|22->164|165->309

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55040.1 GT:GENE ACF55040.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1380713..1381726 GB:FROM 1380713 GB:TO 1381726 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55040.1 GB:DB_XREF GI:194356592 LENGTH 337 SQ:AASEQ MKETVYFGTYTRRTSQGIYKADFDTETGQLSNLELFAAEPSPTYLAFDQHQHLYTVGSQDDXGGIAAYQTDGTVLNHVVEEGAPHCYVAVDEKRDLVYAANYHKGQVLVYKRQEDGSLLLSDMDQHSGQGPHENQASPHVHYTDLTPDHYLVTCDLGTDQVITYDLDQEGKLSKLYTYHSKPGAGSRHIIFHNHYKIAYLICELNSTIEVLIYDGVGEFVRMQVISTLPEAYEGFNGTAAIHLSKDGKYLYASNRGHDSIAVYTILADGSLELLEIVPTHGQTPRDFDLTPDQKFLIVVHQDSDNATVFKRNCDNGRLAELSNEFHVPEAVCIRFAP GT:EXON 1|1-337:0| BL:SWS:NREP 1 BL:SWS:REP 1->333|Y2431_LACLM|7e-97|53.5|333/341| NREPEAT 1 REPEAT 2|22->164|165->309| BL:PDB:NREP 1 BL:PDB:REP 2->335|3hfqA|1e-86|48.5|332/338| RP:PDB:NREP 2 RP:PDB:REP 42->270|2dg0E|7e-04|9.4|223/316| RP:PDB:REP 243->326|1c5kA|8e-06|20.7|82/397| RP:PFM:NREP 1 RP:PFM:REP 17->318|PF10282|2e-58|44.0|291/311|Muc_lac_enz| HM:PFM:NREP 1 HM:PFM:REP 4->335|PF10282|2.9e-116|46.7|332/345|Muc_lac_enz| RP:SCP:NREP 1 RP:SCP:REP 145->298|1jmxB|5e-10|16.2|148/339|b.69.2.2| HM:SCP:REP 10->337|1qksA2|1.8e-37|25.9|301/0|b.70.2.1|1/1|C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase| OP:NHOMO 414 OP:NHOMOORG 348 OP:PATTERN ---------------------------1---------------------------------------- 2-2-2---------------------------------1------11-111111---1--11--1-22221---------1-------1121--------12-1-2-2-1-----------------------------------------------------------------------------------11111111111111111-1111112----2--111111-21111111111111111111111111112111111111111211111-------1--11111111111-------------111---1111---11-------1-1-----1111-----1--------------------1-2-----------111---------------------------1------------------1------------11111111-111--------------------------------------------222112111111113111111111------112-----1-1-2----------------------------------------------------1-----------------------------1-1--1------------------------1------1-----1111-211111111111-1111111111111--11-2222221111111111111111111211111111-2111111-1111111------------------------------111111----1-11111111-11111111-------------------11111----------------------------------1------------------------------------2- ------2----------111----1-1------1111111-11-----22121233-111--------------------------11---1-----1---3-1-1-11------------------------------------------------------------------1---2---------1-11254571 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 336 STR:RPRED 99.7 SQ:SECSTR #EEEEEEEEcccccccEEEEEEEETTTTEEEEEEEEEEcccEEEEEEcTTccEEEEEcTTcccccEEEEEcTTccccEEEEccccccccEEEEEcTTccEEEEEccccTTcccEEEEEEcTTcccEEEEEEEEccEEEEEEcTTEcTccEEEEEEGGGTEEEEEEEcTTcccEEEEEEEEEEEcccccEEEEEEEcTTccEEEEETTTEEEEEcTTccEEEEEEcTTGGGTcccccEEEEEEEcTTccEEEEEEcTTcccEEEEEETTccccEEEEccccccEEEEEEEcTTccEEEEEEEETTEEEEEEEETTTccEEEcccccccTTEEEEEEcc DISOP:02AL 1-1| PSIPRED cccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEccccccEEEEEcccccEEEEEccccccEEEEEEccccEEEEEEccccccEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEEcccccccccccccEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEEEccccccccEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEEccccccccccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEEccccccEEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEEEEEcccEEEEEEcc //