[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55041.1
DDBJ      :             iron ABC transporter, iron-binding protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  171/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->199 1xvxA PDBj 4e-08 26.3 %
:RPS:PDB   30->199 1d9vA PDBj 1e-16 19.0 %
:RPS:SCOP  30->193 1q35A  c.94.1.1 * 3e-28 25.9 %
:HMM:SCOP  25->193 1xvxA_ c.94.1.1 * 1.8e-35 39.0 %
:HMM:PFM   40->188 PF01547 * SBP_bac_1 1.2e-09 24.3 140/314  
:BLT:SWISS 30->193 Y131_HAEIN 2e-17 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55041.1 GT:GENE ACF55041.1 GT:PRODUCT iron ABC transporter, iron-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(213579..214187) GB:FROM 213579 GB:TO 214187 GB:DIRECTION - GB:PRODUCT iron ABC transporter, iron-binding protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF55041.1 GB:DB_XREF GI:194356593 LENGTH 202 SQ:AASEQ MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMNIEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVK GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 30->193|Y131_HAEIN|2e-17|36.3|157/346| SEG 9->29|aacssnesaddsssdkgdggs| BL:PDB:NREP 1 BL:PDB:REP 30->199|1xvxA|4e-08|26.3|167/311| RP:PDB:NREP 1 RP:PDB:REP 30->199|1d9vA|1e-16|19.0|168/309| HM:PFM:NREP 1 HM:PFM:REP 40->188|PF01547|1.2e-09|24.3|140/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 30->193|1q35A|3e-28|25.9|158/317|c.94.1.1| HM:SCP:REP 25->193|1xvxA_|1.8e-35|39.0|164/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 236 OP:NHOMOORG 182 OP:PATTERN -------------------------------------1111-------------1211111------- -------------------------1----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------2222222212222222-----222-------------11-11111111111111-11----------------------------1111111---11111-1----1111111111111---------------1111111112-3------1211-2---------2---------1--------------------------11111111111--------------33-11--111-------1-----2-----------------------------------------------------11---1111111111111111111-1111--1--------1------2-----------------------------------------------------------------------------------------------------------------------------1-1--2--11--------1-----1---1-----------11112--------------------------1-----------------------------222443--1-11224-----------1-------1----------------------111111---11-----------------6--------------1---------------------------1--1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 85.6 SQ:SECSTR #############################EEEEEcccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHGGGccccEEEEccGGGHHHHHHccccccHHHHHTTccTTccTTcccEEEEEEEEEEEEETTccGGGccccGGGGGcGGGTTcEEEEEcTTcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHEEEcccHHH DISOP:02AL 1-2,14-28,202-203| PSIPRED cHHHHHHHHHHHHcccccccccHHccccEEEEEEcccHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHccccccccEEEEccHHHHHHHcccccccccccHHHccHHHccccccEEEEEEEEEEEEEEHHHccccccccHHHHHcHHHccEEEEEcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc //