[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55049.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   85->241 PF10978 * DUF2785 4e-29 48.0 %
:HMM:PFM   81->243 PF10978 * DUF2785 2.9e-51 36.7 158/175  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55049.1 GT:GENE ACF55049.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1610007..1610798) GB:FROM 1610007 GB:TO 1610798 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55049.1 GB:DB_XREF GI:194356601 LENGTH 263 SQ:AASEQ MYQDLLRKIAEEKPNYNQEEIQWLLDHLGDPSPEIRDDLVFTSFAKEIQEELFTQEQFHFIAEVVLADVGLDKEIDKVGLSTLERSFRALIYANLLSADANQQSVFYQELNAGFRNDLSNQGLHYLSKEKDTTGFSSQYGWVHSFAHGADLLTEVVCHPDFPINRVHEVFNILGQLFKRMSIRFTDDEDWRLARVXYEPILQGKLAQEQVASWIKTVDFPIEEREDFYKFSNFRSCLVEVYVQLDQRNSLQDELKEAIQSFQY GT:EXON 1|1-263:0| RP:PFM:NREP 1 RP:PFM:REP 85->241|PF10978|4e-29|48.0|152/173|DUF2785| HM:PFM:NREP 1 HM:PFM:REP 81->243|PF10978|2.9e-51|36.7|158/175|DUF2785| OP:NHOMO 50 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---1-11------------2--1-----12-------------------------12--1--12--22----1-----1-----1--11111111211-------------111---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,263-264| PSIPRED cHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcc //