[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55050.1
DDBJ      :             isochorismatase family protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  159/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:166 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->160 2a67B PDBj 2e-17 29.7 %
:RPS:PDB   2->160 2a67A PDBj 2e-29 29.9 %
:RPS:SCOP  2->138 1nf8A  c.33.1.3 * 6e-27 17.5 %
:HMM:SCOP  1->165 1nbaA_ c.33.1.3 * 2.1e-36 28.5 %
:RPS:PFM   4->135 PF00857 * Isochorismatase 7e-11 32.6 %
:HMM:PFM   3->138 PF00857 * Isochorismatase 9e-32 27.2 136/174  
:BLT:SWISS 2->160 YRDC_BACSU 7e-10 27.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55050.1 GT:GENE ACF55050.1 GT:PRODUCT isochorismatase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1599027..1599527) GB:FROM 1599027 GB:TO 1599527 GB:DIRECTION - GB:PRODUCT isochorismatase family protein GB:PROTEIN_ID ACF55050.1 GB:DB_XREF GI:194356602 LENGTH 166 SQ:AASEQ MKTAFIIIDVQNVLVETGFQTKSLLEKISYLQNQARSKNIEIIYVQHIENSEAQTSEDWQXXALLNRKPAEKVFQKKYNSIFKETGLKEYLDKQGIEKLVLCGMQTEYCVDTSVKVAFEYGYQLIVPEGAVTTFDGDDIPAETINEFYEDIWEEHFADVLDYKHIF GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 2->160|YRDC_BACSU|7e-10|27.0|159/187| BL:PDB:NREP 1 BL:PDB:REP 4->160|2a67B|2e-17|29.7|155/164| RP:PDB:NREP 1 RP:PDB:REP 2->160|2a67A|2e-29|29.9|157/163| RP:PFM:NREP 1 RP:PFM:REP 4->135|PF00857|7e-11|32.6|132/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 3->138|PF00857|9e-32|27.2|136/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 2->138|1nf8A|6e-27|17.5|137/207|c.33.1.3| HM:SCP:REP 1->165|1nbaA_|2.1e-36|28.5|165/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 277 OP:NHOMOORG 182 OP:PATTERN ----1-------------------1---1--------------1---1---1---------------- -2--1----------------1----------1--------1------------1--1------1-1--2-------------------------------1------------------------------------------21-----------------------------------------------1656566351566566-----1553---2-1111111-11---------------1----1-1-11-----1111--2-1-111211111---1-111111111111--------1----111---------112111----1---1-------------1---------------------1-----------------------------------------------11-111-11-1-----------------------------------------------------------------1-----222121-----11-1------1-----1----------2---1---1--1-21-----------1-----------1-----11-----1-----------------------------------11---------1-------121----------------------1-1-21------------------------------12111-------------------2---------2--------------------------1-1---------------11111-1--21-1111-111------1--------------1-------1--1------------------------------------------------------------------------- ----11------------1--1---1-1111-1-1------------1--1--1-------------------------------------------------1-3----------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 97.0 SQ:SECSTR GcEEEEEEcccTTccccccccTHHHHHHHHHHHHHHHTTccEEEEEEccTTccTTcTTTcccTTccccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHHTcEEEcTTcEEcccccccHcHHHHHHHHHHHHcTTTcEEcc##### PSIPRED ccEEEEEEcccHHHccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHccccccEEEEcccccccccHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEccEEEcccHHHccHHHHHHHHHHHHHHcccEEEEHHHHc //