[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55053.1
DDBJ      :             ribonuclease HII
Swiss-Prot:RNH2_STRPS   RecName: Full=Ribonuclease HII;         Short=RNase HII;         EC=3.1.26.4;

Homologs  Archaea  0/68 : Bacteria  856/915 : Eukaryota  21/199 : Viruses  1/175   --->[See Alignment]
c.55.3
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->253 2etjA PDBj 7e-26 43.7 %
:RPS:PDB   72->256 2dffA PDBj 1e-47 22.7 %
:RPS:SCOP  63->253 2etjA1  c.55.3.1 * 1e-56 38.8 %
:HMM:SCOP  59->253 2etjA1 c.55.3.1 * 1.3e-67 52.6 %
:RPS:PFM   102->248 PF01351 * RNase_HII 7e-29 50.0 %
:HMM:PFM   73->249 PF01351 * RNase_HII 2.1e-51 38.1 176/198  
:HMM:PFM   54->85 PF03795 * YCII 0.00065 43.8 32/95  
:BLT:SWISS 1->259 RNH2_STRPS e-130 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55053.1 GT:GENE ACF55053.1 GT:PRODUCT ribonuclease HII GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1032537..1033316 GB:FROM 1032537 GB:TO 1033316 GB:DIRECTION + GB:PRODUCT ribonuclease HII GB:NOTE identified by match to protein family HMM PF01351 GB:PROTEIN_ID ACF55053.1 GB:DB_XREF GI:194356605 LENGTH 259 SQ:AASEQ MATIKEIKELLVTVKELESPIFLELEKDNRSGVQKEISKRKRAIQAELDENLRLESMLSYEKELYKQGLTLIAGIDEVGRGPLAGPVVAAAVILPKNCKIKGLNDSKKIPKKKHLEIFQAVQDQALSIGIGIIDNQVIDQVNIYEATKLAMQEAISQLSPQPEHLLIDAMKLDLPISQTSIIKGDANSLSIAAASIVAKVTRDELMKEYDQQFPGYDFATNAGYGTAKHLEGLTKLGVTPIHRTSFEPVKSLVLGKKES GT:EXON 1|1-259:0| SW:ID RNH2_STRPS SW:DE RecName: Full=Ribonuclease HII; Short=RNase HII; EC=3.1.26.4; SW:GN Name=rnhB; OrderedLocusNames=SPCG_1140; SW:KW Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Manganese;Metal-binding; Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->259|RNH2_STRPS|e-130|100.0|259/259| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0004519|"GO:endonuclease activity"|Endonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| SEG 78->95|vgrgplagpvvaaavilp| BL:PDB:NREP 1 BL:PDB:REP 63->253|2etjA|7e-26|43.7|174/206| RP:PDB:NREP 1 RP:PDB:REP 72->256|2dffA|1e-47|22.7|185/210| RP:PFM:NREP 1 RP:PFM:REP 102->248|PF01351|7e-29|50.0|146/190|RNase_HII| HM:PFM:NREP 2 HM:PFM:REP 73->249|PF01351|2.1e-51|38.1|176/198|RNase_HII| HM:PFM:REP 54->85|PF03795|0.00065|43.8|32/95|YCII| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01351|IPR001352| GO:PFM GO:0004523|"GO:ribonuclease H activity"|PF01351|IPR001352| RP:SCP:NREP 1 RP:SCP:REP 63->253|2etjA1|1e-56|38.8|178/211|c.55.3.1| HM:SCP:REP 59->253|2etjA1|1.3e-67|52.6|192/0|c.55.3.1|1/1|Ribonuclease H-like| OP:NHOMO 902 OP:NHOMOORG 878 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111-1-11-1-11------111111-1-1-------1111-111111111-1112--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111211111111111111111111111-111111111111111111111111111111111-1111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111-12111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111--11111111111111111-1----1-1-1-1-----111------1111111111111 --------211---------------------------------------------------------------------------------------------------------------------------------------------------------------5----1111A1111-2-----1221111- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- STR:NPRED 257 STR:RPRED 99.2 SQ:SECSTR ##HHHHHHHHccccccccccTTEEEEEEETTEEEEEETTcEEEEEcTcEEEccHHHHHHHHHccEEEEEEEEEEEEEEccccccccEEEEEEEEETTTHTTTGGGGccccHHHHHHHHHHHHTTccEEEEEEEcHHHHTTccHHHHHHHHHHHHHTTccccccEEEEEEcTcccccEEEEEETcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccTTccTTcHHHHHHHHHHHHccccTTccTTcTHHHHHHHHcHHT DISOP:02AL 1-1,42-51,256-260| PSIPRED cccHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccEEEEEEccccccccccEEEEEEEEcccccccccccHHcccHHHHHHHHHHHHHHHHEEEEEEEcHHHHHHccHHHHHHHHHHHHHHcccccccEEEEccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccEEEcccHHHHHHHHccccc //