[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55054.1
DDBJ      :             Tn5253 conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->99 1tp7A PDBj 1e-04 33.8 %
:BLT:SWISS 22->146 RBP2_PLAVB 8e-04 29.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55054.1 GT:GENE ACF55054.1 GT:PRODUCT Tn5253 conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1248272..1248760) GB:FROM 1248272 GB:TO 1248760 GB:DIRECTION - GB:PRODUCT Tn5253 conserved hypothetical protein GB:PROTEIN_ID ACF55054.1 GB:DB_XREF GI:194356606 LENGTH 162 SQ:AASEQ MSSEQQERMAVQYAERSLLFTVKSLLKILEWSRRQALAQDSAYKIGVQKLEELLQSPYSIDTINLKKDFLDKPIDIEKFKAFLEKEEIPLAIAWQGDSLHFYTKDRSILDNHLDHLLEKMVNDPEKLADFIMDKSLDDAIDEAKSQITFRQEGAVKQKEMVR GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 22->146|RBP2_PLAVB|8e-04|29.1|110/100| BL:PDB:NREP 1 BL:PDB:REP 35->99|1tp7A|1e-04|33.8|65/450| OP:NHOMO 16 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---1------11311--1--------------11---2-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 40.1 SQ:SECSTR ##################################ccccHHHHHcTTcccccccccccTTGGGTTccGGGTTTTTccHHHHHHHHHHcccccEEEEcccE############################################################### DISOP:02AL 1-12,157-157,162-163| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHccccHHHHHHHHHcccccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHEEEEcccHHHHHHHcc //