[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55058.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  146/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:RPS:PFM   1->63 PF06107 * DUF951 7e-16 64.3 %
:HMM:PFM   1->63 PF06107 * DUF951 6.2e-32 58.9 56/57  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55058.1 GT:GENE ACF55058.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 2918..3112 GB:FROM 2918 GB:TO 3112 GB:DIRECTION + GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF06107 GB:PROTEIN_ID ACF55058.1 GB:DB_XREF GI:194356610 LENGTH 64 SQ:AASEQ MYQVGNFVEMKKSHACTIKSTGKKANRWEITRVGADIKIKCSNCEHVVMMGRYDFERKMNKIID GT:EXON 1|1-64:0| RP:PFM:NREP 1 RP:PFM:REP 1->63|PF06107|7e-16|64.3|56/57|DUF951| HM:PFM:NREP 1 HM:PFM:REP 1->63|PF06107|6.2e-32|58.9|56/57|DUF951| OP:NHOMO 146 OP:NHOMOORG 146 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111-1111--11111-1111111111111111-111111111111-11111111111111111111111111111-111111111111111111111111-111111111111111111111---1-1111111-1-1-111111--1-1----------1-1--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccEEEEccccccccccccccccEEEEEEEccccEEEEccccEEEEEEHHHHHHHHHHHcc //