[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55062.1
DDBJ      :             alpha-1,2-mannosidase, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  70/199 : Viruses  0/175   --->[See Alignment]
a.102.1
:694 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   238->690 3cihA PDBj 4e-22 8.5 %
:RPS:SCOP  215->648 1h54A1  a.102.1.4 * 6e-30 11.7 %
:HMM:SCOP  226->670 1v7wA1 a.102.1.4 * 1.9e-24 22.7 %
:RPS:PFM   200->688 PF07971 * Glyco_hydro_92 1e-86 40.1 %
:HMM:PFM   205->689 PF07971 * Glyco_hydro_92 6.7e-132 36.8 468/500  
:BLT:SWISS 552->665 NADD_BUCAT 4e-04 38.0 %
:PROS 683->690|PS00256|AKH

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55062.1 GT:GENE ACF55062.1 GT:PRODUCT alpha-1,2-mannosidase, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1971471..1973555 GB:FROM 1971471 GB:TO 1973555 GB:DIRECTION + GB:PRODUCT alpha-1,2-mannosidase, putative GB:NOTE identified by match to protein family HMM PF07971; match to protein family HMM TIGR01180 GB:PROTEIN_ID ACF55062.1 GB:DB_XREF GI:194356614 LENGTH 694 SQ:AASEQ MKPLLETIDTRFGTASKHAFSRGNTLPYTGVPLGMNYFVPQTSDQGGSWFFDPHLPIFQGIRLTHQPSPWIGDYSWLLLTPVTSQLGGDSLFHRQSSYDIDKACFQPHYLKLFSLRYQIETQLTPTCYGASIRLNQKQGKALSLYLHAADELTVEQVDKRTLALRQEGKTETNKNPLMLFTALQMNTDILAISQEAGDWRIDLASSQTEMQLATSFISPSQALINLPQEDFDSCKTSAQADWENLLHRFDIIETGEADRTFFDHCLYRLFLFPQTFYEVDESGQAIHMDLATGTVKPGVLFSNNGFWDTFRTTFPLFALIIPEHYQRFLEGFLNSYRDTGFLPKWLAPDERGMMPGTLLDGIIADSACKDMAPDLEGELFQAMLETASKADPLGINGRHGLAQYQELGYLSTDHHESVSHTLDYAYSDFCIASCAKKLENIEIAETYKAASQNYRQLFDAETGYMRARDNQGNFHPDFSPYSWGRDYAECSAIQATLGVLHDIPGLIQLMGGKETFSNYLLKACQDAPLFETTGYGYEIHEMSEMATAPFGQIAISNQPSFHIPYLFRYSDYPDYTALLIKTLRQKAFHPSWEAYPGDEDNGSLSAWYIWSALGFYPTCPGKPSYDLGIPLFDHLRVYLAKEDKWLDIHTKQNHNHFNFVKECRLNKTLVSTIQHQDLLKAEQLTFTLSWLPSH GT:EXON 1|1-694:0| BL:SWS:NREP 1 BL:SWS:REP 552->665|NADD_BUCAT|4e-04|38.0|92/100| PROS 683->690|PS00256|AKH|PDOC00229| RP:PDB:NREP 1 RP:PDB:REP 238->690|3cihA|4e-22|8.5|426/690| RP:PFM:NREP 1 RP:PFM:REP 200->688|PF07971|1e-86|40.1|474/496|Glyco_hydro_92| HM:PFM:NREP 1 HM:PFM:REP 205->689|PF07971|6.7e-132|36.8|468/500|Glyco_hydro_92| RP:SCP:NREP 1 RP:SCP:REP 215->648|1h54A1|6e-30|11.7|409/485|a.102.1.4| HM:SCP:REP 226->670|1v7wA1|1.9e-24|22.7|423/0|a.102.1.4|1/1|Six-hairpin glycosidases| OP:NHOMO 429 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- 313-3----------1111-1---1-11111--------------21----------1--11--3-1321------------2-----98N9-E44---147---8-2-4--------------------------------------------------------------------------------------------------------------------------1--------------------1----------11----------1-----11111--11111111111--------------11---111---------------------------1--------------------------122---------------------------------------------------------------------------------------------------------------------1---------3332--1111----1111-14-------------------------------------------------------------------------------------------------------------2-4--6---------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5----334444411-1111-----------------------------------------------1----------- ------1------1-677354536566--111122221111--1114577----33612222--1111-1--1--------11111---36372321111--2-----11---------------------------------------------------------------1---------------5----2---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 455 STR:RPRED 65.6 SQ:SECSTR ##################################################################################################################################################################################################################################cHHHHHHHHHHEEccccEEEEEEEEEEcTTEEEEEEEEEEEcccccccEEEEccHHHHHHHHHHHHHHHTccccccccccccccccHHHHHHHHHHHTTTccHHHHHHHHHHHccHccccccccGGGcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHTTccTTccccTTccccccccTTccccccEEHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHEcEEEETTTTEEccEEETTEEcccccHHHHHHHHTTcccHTTTTTcccccHHHHHHHHHHHTTTcTTccccccHHHHHHHHHHHHTTcHHHHHH#########HHHHHHHTTTcccccccccTTccGGGGGcTTcTTcccTHHHHHHHHTccEEEEEGGGTEEEEccTccEEEEEEETTEEEEEEEccEEEEEEcccEEEEEEEccccEEcccEEEEETTEEEEEEcc#### DISOP:02AL 692-695| PSIPRED cccHHHHccccEEccccccccccccccccccccccEEEEEEccccccccEEcccccEEEEEEEEccccccccccccEEEEEEccccccccccHHHccccccccEEEEEEEEEEEcccccEEEEEEccEEEEEEEEcccccccEEEEEEccccEEEEEcccEEEEEEEEccccccccEEEEEEEEEccccccccccccEEEEcccccEEEEEEEEEcccHHHHHHcHHHHcHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHcccEEEcccccccccccccccEEcccccEEccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccEEcccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHEEEEccccHHHHHHHHccHHHHHHHHHHHHccccccccccccccEEccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccEEEEEcccccEEEEEEcccccEEEEEEcccccccccEEEEEEccEEcccccHHHHHcccEEEEEEcccccc //