[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55067.1
DDBJ      :             4-oxalocrotonate tautomerase
Swiss-Prot:Y921_STRR6   RecName: Full=Probable tautomerase spr0921;         EC=5.3.2.-;

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->60 4otaI PDBj 1e-09 44.1 %
:RPS:PDB   2->56 3ej7C PDBj 9e-14 30.9 %
:RPS:SCOP  2->56 1s0yA  d.80.1.1 * 8e-13 30.9 %
:HMM:SCOP  2->60 1bjpA_ d.80.1.1 * 4.9e-16 47.5 %
:RPS:PFM   2->47 PF01361 * Tautomerase 2e-08 54.3 %
:HMM:PFM   2->57 PF01361 * Tautomerase 5.8e-27 48.2 56/60  
:BLT:SWISS 1->60 Y921_STRR6 1e-30 98.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55067.1 GT:GENE ACF55067.1 GT:PRODUCT 4-oxalocrotonate tautomerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(908645..908827) GB:FROM 908645 GB:TO 908827 GB:DIRECTION - GB:PRODUCT 4-oxalocrotonate tautomerase GB:NOTE identified by match to protein family HMM PF01361 GB:PROTEIN_ID ACF55067.1 GB:DB_XREF GI:194356619 LENGTH 60 SQ:AASEQ MPFVRIDLFEGRTLEQKKALAKEVTEAIVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK GT:EXON 1|1-60:0| SW:ID Y921_STRR6 SW:DE RecName: Full=Probable tautomerase spr0921; EC=5.3.2.-; SW:GN OrderedLocusNames=spr0921; SW:KW Complete proteome; Isomerase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|Y921_STRR6|1e-30|98.3|60/60| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 2->60|4otaI|1e-09|44.1|59/59| RP:PDB:NREP 1 RP:PDB:REP 2->56|3ej7C|9e-14|30.9|55/59| RP:PFM:NREP 1 RP:PFM:REP 2->47|PF01361|2e-08|54.3|46/59|Tautomerase| HM:PFM:NREP 1 HM:PFM:REP 2->57|PF01361|5.8e-27|48.2|56/60|Tautomerase| GO:PFM:NREP 2 GO:PFM GO:0006725|"GO:cellular aromatic compound metabolic process"|PF01361|IPR004370| GO:PFM GO:0016853|"GO:isomerase activity"|PF01361|IPR004370| RP:SCP:NREP 1 RP:SCP:REP 2->56|1s0yA|8e-13|30.9|55/62|d.80.1.1| HM:SCP:REP 2->60|1bjpA_|4.9e-16|47.5|59/62|d.80.1.1|1/1|Tautomerase/MIF| OP:NHOMO 71 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------111-11-111111111111111-11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEETTccHHHHHHHHHHHHHHHHHHHcccGGGcEEEEEEEcGGGcEETTEcccT DISOP:02AL 59-61| PSIPRED ccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEEccccEEEccEEccc //