[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55075.1
DDBJ      :             RRF2 family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  156/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->136 1xd7A PDBj 2e-22 45.2 %
:RPS:PDB   14->63 2acjC PDBj 8e-04 22.0 %
:RPS:SCOP  12->102 1f6vA  a.49.1.1 * 2e-09 11.5 %
:HMM:SCOP  5->137 1xd7A_ a.4.5.55 * 2.7e-32 37.8 %
:RPS:PFM   1->82 PF02082 * Rrf2 3e-09 35.4 %
:HMM:PFM   1->82 PF02082 * Rrf2 2.8e-25 37.8 82/83  
:BLT:SWISS 3->136 YWNA_BACSU 9e-28 46.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55075.1 GT:GENE ACF55075.1 GT:PRODUCT RRF2 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1487570..1488007) GB:FROM 1487570 GB:TO 1488007 GB:DIRECTION - GB:PRODUCT RRF2 family protein GB:NOTE identified by match to protein family HMM PF02082 GB:PROTEIN_ID ACF55075.1 GB:DB_XREF GI:194356627 LENGTH 145 SQ:AASEQ MQIPSRFTIATHMLIIIALEGKESKVTSDFLAASVGVNPVIIRKILSQLKKAELISVARGTGGTEIVKDLKDISLLDVYQAVECLGKTGQLFSFHDNPNPNCPVGAHIHDVLDQKLERIQLTMEAELGQTSLEKVVADAESQMKD GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 3->136|YWNA_BACSU|9e-28|46.1|128/133| BL:PDB:NREP 1 BL:PDB:REP 5->136|1xd7A|2e-22|45.2|115/116| RP:PDB:NREP 1 RP:PDB:REP 14->63|2acjC|8e-04|22.0|50/66| RP:PFM:NREP 1 RP:PFM:REP 1->82|PF02082|3e-09|35.4|82/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->82|PF02082|2.8e-25|37.8|82/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 12->102|1f6vA|2e-09|11.5|78/91|a.49.1.1| HM:SCP:REP 5->137|1xd7A_|2.7e-32|37.8|127/127|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 218 OP:NHOMOORG 156 OP:PATTERN -------------------------------------------------------------------- 1-----------------------------------------------------------------1-1-------11---2-------------------1-----1------------------------------------1--------------------------------------21-----1--2333332331333333112221332-1-1-1-11111122---------------1----1-32--23--122----11-111----------1--11111111111-------------133111333------1111111-1-------------------11-----------------1------------------1--1------------1-----1------------111-1------1--------------------11----------------------------------1-------1111121111111111111111111112----1-----1-----------------------------------------------------1-11---11---------1---------------------------------1--------------------------1--------------------------------------11------------------------------------------------------1------------------------------------1--------------------------------------------------2--1111--------2--------------------1-----------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 85.5 SQ:SECSTR #ccccHHHHHHHHHHHHHHTcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEccccccEEcccGGGccHHHHHHHHcccH###########cccccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHc######### DISOP:02AL 1-1,142-146| PSIPRED ccccHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccccccccccHHHccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcc //