[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55089.1
DDBJ      :             mutT/nudix family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->155 2b06A PDBj 1e-85 100.0 %
:RPS:PDB   1->155 2b06A PDBj 1e-24 89.3 %
:RPS:SCOP  1->155 2b06A1  d.113.1.1 * 8e-25 89.3 %
:HMM:SCOP  1->155 2b06A1 d.113.1.1 * 2.3e-29 27.1 %
:RPS:PFM   38->129 PF00293 * NUDIX 6e-09 37.0 %
:HMM:PFM   19->123 PF00293 * NUDIX 3.3e-17 29.8 104/135  
:BLT:SWISS 18->122 YVCI_BACSU 6e-12 36.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55089.1 GT:GENE ACF55089.1 GT:PRODUCT mutT/nudix family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1102999..1103466) GB:FROM 1102999 GB:TO 1103466 GB:DIRECTION - GB:PRODUCT mutT/nudix family protein GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF55089.1 GB:DB_XREF GI:194356641 LENGTH 155 SQ:AASEQ MSRSQLTILTNICLIEDLETQRVVMQYRAPENNRWSGYAFPGGHVENDEAFAESVIREIYEETGLTIQNPQLVGIKNWPLDTGGRYIVICYKATEFSGTLQSSEEGEVSWVQKDQIPNLNLAYDMLPLMEMMEAPDKSEFFYPRRTEDDWEKKIF GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 18->122|YVCI_BACSU|6e-12|36.3|102/158| BL:PDB:NREP 1 BL:PDB:REP 1->155|2b06A|1e-85|100.0|150/150| RP:PDB:NREP 1 RP:PDB:REP 1->155|2b06A|1e-24|89.3|150/150| RP:PFM:NREP 1 RP:PFM:REP 38->129|PF00293|6e-09|37.0|92/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 19->123|PF00293|3.3e-17|29.8|104/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 1->155|2b06A1|8e-25|89.3|150/150|d.113.1.1| HM:SCP:REP 1->155|2b06A1|2.3e-29|27.1|155/0|d.113.1.1|1/1|Nudix| OP:NHOMO 105 OP:NHOMOORG 75 OP:PATTERN ---------------------------------1---------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------1-222222131112221-1--11211----1---------1--------------------11111-1-1-111-------1--1-1-11----21122222132122-------------3121112222-----------------------1--11-11------------------1-------------------1-------------------------1---------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR ccGGGcEEEEEEEEEEETTTTTEEEEEEcEcccEEEcEEcccccccTTccHHHHHHHHHHHHHcEEEEccEEEEEEEEEcTTccEEEEEEEEEcEEEEcccccTTcEEEEEEGGGGGGccccTTHHHHHHHHHcTTccEEEcccccTTccccEEc DISOP:02AL 1-3| PSIPRED ccccccEEEEEEEEEEEccccEEEEEEEcccccccccEEcccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEEEEcccccEEEEEEEEEEEcccccccccccEEEEEcHHHcccccccccHHHHHHHHHcccccEEEEEccccccccHHcc //