[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55097.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:HMM:PFM   55->120 PF01943 * Polysacc_synt 1.2e-05 20.0 65/273  
:HMM:PFM   8->53 PF02949 * 7tm_6 0.00032 26.1 46/312  
:HMM:PFM   118->141 PF02517 * Abi 0.00039 37.5 24/99  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55097.1 GT:GENE ACF55097.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 385154..385588 GB:FROM 385154 GB:TO 385588 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF55097.1 GB:DB_XREF GI:194356649 LENGTH 144 SQ:AASEQ MLIILLSTYLPQTIGLYVTIILGLGADVYSLILTMGLVGSFLLLIWRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLINHRNIHDEYFTVLFSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP GT:EXON 1|1-144:0| TM:NTM 3 TM:REGION 23->45| TM:REGION 63->85| TM:REGION 110->132| SEG 48->60|lkkkkmlfifekk| HM:PFM:NREP 3 HM:PFM:REP 55->120|PF01943|1.2e-05|20.0|65/273|Polysacc_synt| HM:PFM:REP 8->53|PF02949|0.00032|26.1|46/312|7tm_6| HM:PFM:REP 118->141|PF02517|0.00039|37.5|24/99|Abi| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1122211--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEHHEHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //