[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55098.1
DDBJ      :             competence protein CglC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  16->97 2pilA_ d.24.1.1 * 8.8e-14 28.0 %
:HMM:PFM   14->33 PF07963 * N_methyl 4.5e-08 60.0 20/20  
:BLT:SWISS 37->99 COMGC_BACHD 1e-04 28.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55098.1 GT:GENE ACF55098.1 GT:PRODUCT competence protein CglC GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1862286..1862612) GB:FROM 1862286 GB:TO 1862612 GB:DIRECTION - GB:PRODUCT competence protein CglC GB:NOTE identified by match to protein family HMM PF07963; match to protein family HMM TIGR02532 GB:PROTEIN_ID ACF55098.1 GB:DB_XREF GI:194356650 LENGTH 108 SQ:AASEQ MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLKEDGRITEEQAKAYKEYNDKNVGANRKVND GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 37->99|COMGC_BACHD|1e-04|28.6|63/100| TM:NTM 1 TM:REGION 16->38| SEG 18->36|lvemlvvlliisvlfllfv| HM:PFM:NREP 1 HM:PFM:REP 14->33|PF07963|4.5e-08|60.0|20/20|N_methyl| HM:SCP:REP 16->97|2pilA_|8.8e-14|28.0|82/158|d.24.1.1|1/1|Pili subunits| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------111-1111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,45-46,96-109| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHHcccccccccc //