[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55102.1
DDBJ      :             Cof family protein/peptidyl-prolyl cis-trans isomerase, cyclophilin type
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  745/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.62.1c.108.1
:466 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->267 2qyhB PDBj 3e-30 36.2 %
:BLT:PDB   283->432 2ojuB PDBj 3e-28 52.0 %
:RPS:PDB   3->264 3daoB PDBj 3e-27 18.5 %
:RPS:PDB   286->453 2b71A PDBj 7e-29 46.0 %
:RPS:SCOP  13->267 1ymqA1  c.108.1.10 * 3e-48 28.9 %
:RPS:SCOP  280->453 1a33A  b.62.1.1 * 1e-25 37.2 %
:HMM:SCOP  3->268 2b30A1 c.108.1.10 * 1.5e-59 33.8 %
:HMM:SCOP  263->464 1z81A1 b.62.1.1 * 3.7e-58 50.3 %
:RPS:PFM   18->261 PF08282 * Hydrolase_3 2e-35 39.0 %
:RPS:PFM   288->453 PF00160 * Pro_isomerase 5e-36 56.9 %
:HMM:PFM   15->261 PF08282 * Hydrolase_3 1.6e-56 33.3 246/254  
:HMM:PFM   286->463 PF00160 * Pro_isomerase 3.7e-46 51.0 147/155  
:BLT:SWISS 1->453 BPPI_STRP6 e-169 64.9 %
:PROS 320->337|PS00170|CSA_PPIASE_1
:PROS 215->237|PS01229|COF_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55102.1 GT:GENE ACF55102.1 GT:PRODUCT Cof family protein/peptidyl-prolyl cis-trans isomerase, cyclophilin type GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1412412..1413812) GB:FROM 1412412 GB:TO 1413812 GB:DIRECTION - GB:PRODUCT Cof family protein/peptidyl-prolyl cis-trans isomerase, cyclophilin type GB:NOTE identified by match to protein family HMM PF00160; match to protein family HMM PF00702; match to protein family HMM PF05116; match to protein family HMM PF08282; match to protein family HMM TIGR00099; match to protein family HMM TIGR01484 GB:PROTEIN_ID ACF55102.1 GB:DB_XREF GI:194356654 LENGTH 466 SQ:AASEQ MDAKLRYKAKKIKIVFFDIDDTLRNSKTGFIPTTIPTVFKQLREKGILTGIASGRGIFGVVPEIRDLKPDFFVTLNGAYIEDKKGQVIYQHQIEKSYVEEYISWAKQEGIEYGLVGSHDAKLSTRTDMMSEAINPIYPDLDVDPDFHEKEDIYQMWTFEDKGDDLHLPDSLSDKLRMVRWHQHSSDIVPISGSKATGVEKVVEHLGLKPEKVMVFGDGLNDLELFDYAGISVAMGISHDKIKEKADYITKTLEEDGIFDALEVFGMVEKELHFPQVDIETVEGPLATIKTNHGDLRIKLFPEHAPKTVANFVSLSKDGYYDGVIFHRIIKDFMIQGGDPTGTGMGGESIYGESFEDEFSEELYNIRGALSMANAGPNTNGSQFFXVQNQHLPYSKKEITRGGWPEPIAEIYANQGGTPHLDRRHTVFGQLADEASYAVLDVIAAVETGAMDKPVEDVVIETIEIED GT:EXON 1|1-466:0| BL:SWS:NREP 1 BL:SWS:REP 1->453|BPPI_STRP6|e-169|64.9|453/470| PROS 320->337|PS00170|CSA_PPIASE_1|PDOC00154| PROS 215->237|PS01229|COF_2|PDOC00944| SEG 336->346|ggdptgtgmgg| SEG 454->465|vedvvietieie| BL:PDB:NREP 2 BL:PDB:REP 13->267|2qyhB|3e-30|36.2|240/249| BL:PDB:REP 283->432|2ojuB|3e-28|52.0|123/166| RP:PDB:NREP 2 RP:PDB:REP 3->264|3daoB|3e-27|18.5|259/267| RP:PDB:REP 286->453|2b71A|7e-29|46.0|139/169| RP:PFM:NREP 2 RP:PFM:REP 18->261|PF08282|2e-35|39.0|241/253|Hydrolase_3| RP:PFM:REP 288->453|PF00160|5e-36|56.9|137/151|Pro_isomerase| HM:PFM:NREP 2 HM:PFM:REP 15->261|PF08282|1.6e-56|33.3|246/254|Hydrolase_3| HM:PFM:REP 286->463|PF00160|3.7e-46|51.0|147/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 2 RP:SCP:REP 13->267|1ymqA1|3e-48|28.9|253/260|c.108.1.10| RP:SCP:REP 280->453|1a33A|1e-25|37.2|145/174|b.62.1.1| HM:SCP:REP 3->268|2b30A1|1.5e-59|33.8|266/0|c.108.1.10|1/1|HAD-like| HM:SCP:REP 263->464|1z81A1|3.7e-58|50.3|175/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 4654 OP:NHOMOORG 974 OP:PATTERN ------------------------11111-11111---222212211111211-1-111--1----22 2221112444411122234-32221233333112221111111111111111111111--1121411232222221221-11---1--4453-322---13434312323--------------1-----1---1-22222222211-11111221111111122----21111111111111233-----339888888A768997798566569874444846AAAAA7675222222222222222224278375573766AA22452443347778885555767666667667575666666666666688666677A231693333333937361169973415245421221112111122211242-31--1-----222221121-111--1---------------1-1-1--111111---111--11----1-------------12211-----------11-------------------1--1111111122222222222222222222222222221222212111111211221232222223333211222212211-212112222222122222221242-2211111111111111111112211211433122211232222222222221222221--311-1------35542424444444344-4444444444444444444554452234243434433343433433244441-333333333333---2-----22221121233334532222333422222232222222222332122221222111111111245553333345455221111111111112-16111111---1-11112211211-11-32--2111-212-----1-1-1-111-22 7755CBB-M9928BC9A89888798A788788858668777878769899999978879A9964645555435455554544455397-CFBAABACAA9976FDB28PBaNNKIOE76F86GATN5j8r*Z1OOiBB77IABIGAC58EF79L5IEGHEIOEDEA5DAEBHGFE2EEG*GFECFSFOaBMHDDFCD9O ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 449 STR:RPRED 96.4 SQ:SECSTR #HcccccccccccEEEEcccTTTccTTccccccHHHHHHHHHHHTTcEEEEEccccHHHHHHHTGGGGGGcEEEETTTTEEEcccccEEEEcccHHHHHHHHHHHHcTTcEEEEEccccEEEcccccccHHHHHHTccccEEcccGGGcccccccEEEEEccccTTHHHHHTTTEEEEEETTTEEEEEETTccHHHHHHHHHHHTTccGGGEEEEEccGGGHHHHHHccEEEEETTccHHHHHHccEEEccGGGTHHHHHHHHTHTTHHHHHcccEEEEcEccEEEEEEETTEEEEEEEcTTTcHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEEEETTccccccccTTcccccccccTTcccccTEEEEccccTTcccccEEEEcccTTccccccccccGG###cccccEEccccGGGTTTccEEEEEEEEEcHHHHHHHHTccccTTccc############# DISOP:02AL 1-2,5-7,445-451| PSIPRED cccHHHccccccEEEEEEccccEEcccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEcccEEEEcccccEEEEccccHHHHHHHHHHHHHcccEEEEEEcccEEEEcccHHHHHHHHHHccccEEccccccccccEEEEEEcccHHHHHHHHHHcccEEEEEEcccEEEEEcccccHHHHHHHHHHHHcccHHHEEEEcccccHHHHHHHccccEEEccccHHHHHHcccccccccccHHHHHHHHcccccccccccccccccccccEEEEEccccEEEEEEcccccHHHHHHHHHHHHcccccccEEEEEccccEEEccccccccccccccccccccccccccccccccEEEEEccccccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHccccccccccccEEEEEEEEcc //