[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55103.1
DDBJ      :             SsrA-binding protein
Swiss-Prot:SSRP_STRZT   RecName: Full=SsrA-binding protein;

Homologs  Archaea  0/68 : Bacteria  872/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.111.1
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->116 1j1hA PDBj 8e-22 56.5 %
:RPS:PDB   9->115 2czjA PDBj 8e-35 39.3 %
:RPS:SCOP  7->116 1p6vA  b.111.1.1 * 4e-32 36.4 %
:HMM:SCOP  1->132 1k8hA_ b.111.1.1 * 8.6e-51 56.8 %
:RPS:PFM   9->72 PF01668 * SmpB 5e-21 67.2 %
:HMM:PFM   7->73 PF01668 * SmpB 2.8e-34 59.7 67/68  
:HMM:PFM   69->97 PF06505 * XylR_N 0.00054 50.0 26/103  
:BLT:SWISS 1->155 SSRP_STRZT 1e-66 100.0 %
:PROS 27->39|PS01317|SSRP
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55103.1 GT:GENE ACF55103.1 GT:PRODUCT SsrA-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 868429..868896 GB:FROM 868429 GB:TO 868896 GB:DIRECTION + GB:PRODUCT SsrA-binding protein GB:NOTE identified by match to protein family HMM PF01668; match to protein family HMM TIGR00086 GB:PROTEIN_ID ACF55103.1 GB:DB_XREF GI:194356655 LENGTH 155 SQ:AASEQ MAKGEGKVVAQNKKARHDYTIVDTLEAGMVLTGTEIKSVRAARINLKDGFAQVKNGEVWLSNVHIAPYEEGNIWNQEPERRRKLLLHKKQIQKLEQETKGTGMTLVPLKVYIKDGYAKLLLGLAKGKHDYDKRESIKRREQNRDIARVMKAVNQR GT:EXON 1|1-155:0| SW:ID SSRP_STRZT SW:DE RecName: Full=SsrA-binding protein; SW:GN Name=smpB; OrderedLocusNames=SPT_1227; SW:KW Complete proteome; Cytoplasm; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->155|SSRP_STRZT|1e-66|100.0|155/155| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 27->39|PS01317|SSRP|PDOC01021| SEG 79->97|errrklllhkkqiqkleqe| SEG 117->127|aklllglakgk| BL:PDB:NREP 1 BL:PDB:REP 9->116|1j1hA|8e-22|56.5|108/123| RP:PDB:NREP 1 RP:PDB:REP 9->115|2czjA|8e-35|39.3|107/122| RP:PFM:NREP 1 RP:PFM:REP 9->72|PF01668|5e-21|67.2|64/69|SmpB| HM:PFM:NREP 2 HM:PFM:REP 7->73|PF01668|2.8e-34|59.7|67/68|SmpB| HM:PFM:REP 69->97|PF06505|0.00054|50.0|26/103|XylR_N| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01668|IPR000037| GO:PFM GO:0006412|"GO:translation"|PF01668|IPR000037| RP:SCP:NREP 1 RP:SCP:REP 7->116|1p6vA|4e-32|36.4|107/125|b.111.1.1| HM:SCP:REP 1->132|1k8hA_|8.6e-51|56.8|132/133|b.111.1.1|1/1|Small protein B (SmpB)| OP:NHOMO 883 OP:NHOMOORG 879 OP:PATTERN -------------------------------------------------------------------- 111111111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111--1112211111111111111111111111111111111111111111111111111111111111111111-------1111111111111111111111111-111111-11----111-1-1----11111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-1-11------11111-1111111111-11111 ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------11----------------111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 69.7 SQ:SECSTR ########cEEcHHHHTTcccccEEEEEcccccHHHHHHHccccccTTcEEEEccccEEEEcccccTTcccccccccccccEEccccHHHHHHHHHTTTTTTcccEEEEEEEcTTc####################################### DISOP:02AL 1-5,8-9,152-156| PSIPRED cccccccEEEEcccEEEEEEEEEEEEccEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEEccccccccccEEcccccccHHHHHcHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccc //