[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55112.1
DDBJ      :             L-ribulose-5-phosphate 4-epimerase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  233/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.74.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->143 1jdiA PDBj 1e-44 53.2 %
:RPS:PDB   1->141 1e4aP PDBj 2e-30 21.1 %
:RPS:SCOP  1->143 1jdiA  c.74.1.1 * 2e-41 52.4 %
:HMM:SCOP  1->143 1jdiA_ c.74.1.1 * 2.3e-38 29.4 %
:RPS:PFM   3->116 PF00596 * Aldolase_II 2e-11 38.2 %
:HMM:PFM   2->116 PF00596 * Aldolase_II 1.1e-23 28.2 103/183  
:BLT:SWISS 3->151 ARAD_BACST 3e-50 58.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55112.1 GT:GENE ACF55112.1 GT:PRODUCT L-ribulose-5-phosphate 4-epimerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1850117..1850575) GB:FROM 1850117 GB:TO 1850575 GB:DIRECTION - GB:PRODUCT L-ribulose-5-phosphate 4-epimerase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00596 GB:PROTEIN_ID ACF55112.1 GB:DB_XREF GI:194356664 LENGTH 152 SQ:AASEQ MQLYKAWSEIGSVVHTHSTEAVAWAQAGRDIPFYGTTHADYFYGSIPCARSLTKDEVEVAYEKDTGLVIVEEFEHRGLNPVEVPGIVVRNHGPFTWGKNPENAVYHSVVXEEVSKMNRFTEQINPRVEPAPQYILEKHYQRKHGPNAYYGQK GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 3->151|ARAD_BACST|3e-50|58.5|147/228| BL:PDB:NREP 1 BL:PDB:REP 3->143|1jdiA|1e-44|53.2|141/223| RP:PDB:NREP 1 RP:PDB:REP 1->141|1e4aP|2e-30|21.1|128/205| RP:PFM:NREP 1 RP:PFM:REP 3->116|PF00596|2e-11|38.2|102/181|Aldolase_II| HM:PFM:NREP 1 HM:PFM:REP 2->116|PF00596|1.1e-23|28.2|103/183|Aldolase_II| GO:PFM:NREP 1 GO:PFM GO:0046872|"GO:metal ion binding"|PF00596|IPR001303| RP:SCP:NREP 1 RP:SCP:REP 1->143|1jdiA|2e-41|52.4|143/223|c.74.1.1| HM:SCP:REP 1->143|1jdiA_|2.3e-38|29.4|143/223|c.74.1.1|1/1|AraD-like aldolase/epimerase| OP:NHOMO 349 OP:NHOMOORG 234 OP:PATTERN -----------------------------1-------------------------------------- 111----------------------1-------------------11-----111---11--12------------111-----------11---------1-111-1-1----------------------------------1-------------------------------------------11-111---------------112211----11-1---------1--------------------1-1-11-1---1111111-112----1111111-11111111111111111111111111111---11111--12-------1-111----1-1------1---------------1----------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1-----------------------------112--1---------1---1111----1---------------31221113223333233-232333333323333233323212---3233333333333332212222321-122222222222------------------1111111-1--1111-----------1------------------------------111111-1111-----------------------------------------1--11--111--1111--------1--1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 96.1 SQ:SECSTR HHHHHHcTTccEEEEEccHHHHHHHHTTcccccccGGGGGGTcccccEEccccHHHHccTTcHHHHHHHHHHHTccTcccccccEEEETTTEEEEEEccHHHHHHHHHHHHHHHHHHHHHHTTccccccccHHHHHHHHHHHcccc###### DISOP:02AL 146-147,151-153| PSIPRED cHHHHHcccccEEEEcccHHHHHHHHHccccccccHHHHHHccccccccccccHHHHcccccHHHHHHHHHHHHHccccHHHccEEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccc //