[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55117.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  110/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   76->192 PF09335 * SNARE_assoc 3.5e-19 24.6 114/123  
:BLT:SWISS 45->192 YDJZ_ECOLI 3e-09 21.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55117.1 GT:GENE ACF55117.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1571817..1572434 GB:FROM 1571817 GB:TO 1572434 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF09335 GB:PROTEIN_ID ACF55117.1 GB:DB_XREF GI:194356669 LENGTH 205 SQ:AASEQ MSQDKQMKAVSPLLQRVINISSIVGGVGSLIFCIWAYQAGILQSKETLSAFIQQAGIWGPPLFIFLQILQTVVPIIPGALTSVAGVFIYGHIIGTIYNYIGIVIGCAIIFYLVRLYGAAFVQSVVSKRTYDKYIGWLDKGNRFDRFFIFMMIWPISPADFLCMLAALTKMSFKRYMTIIILTKPFTLVVYTYGLTYIIDFFWQML GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 45->192|YDJZ_ECOLI|3e-09|21.9|146/235| TM:NTM 5 TM:REGION 13->35| TM:REGION 63->85| TM:REGION 102->124| TM:REGION 146->168| TM:REGION 178->200| HM:PFM:NREP 1 HM:PFM:REP 76->192|PF09335|3.5e-19|24.6|114/123|SNARE_assoc| OP:NHOMO 154 OP:NHOMOORG 113 OP:PATTERN ----------------------------1-1------------------------------------- ----------------------------------------------1--------------------------------11---------------------------------------------------------------------11-11------------------------1--1-----------111111111111111------11------1-----------------------------21-1111-111----111-----1111113333122111111111111111111111111111---111211-1-4444434-4------222---11-----22-1------11-1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //