[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55120.1
DDBJ      :             PTS system, IIA component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.54.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->122 1pdoA PDBj 4e-14 38.1 %
:RPS:PDB   3->123 3bedA PDBj 7e-22 23.4 %
:RPS:SCOP  2->123 3bedA1  c.54.1.1 * 3e-27 28.6 %
:HMM:SCOP  1->126 1pdoA_ c.54.1.1 * 1.4e-26 39.5 %
:RPS:PFM   3->111 PF03610 * EIIA-man 1e-13 45.8 %
:HMM:PFM   2->114 PF03610 * EIIA-man 4.2e-35 42.3 111/116  
:BLT:SWISS 3->103 PTNAB_STRP6 1e-17 39.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55120.1 GT:GENE ACF55120.1 GT:PRODUCT PTS system, IIA component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 282720..283148 GB:FROM 282720 GB:TO 283148 GB:DIRECTION + GB:PRODUCT PTS system, IIA component GB:NOTE identified by match to protein family HMM PF03610 GB:PROTEIN_ID ACF55120.1 GB:DB_XREF GI:194356672 LENGTH 142 SQ:AASEQ MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQKILLAISNEEEVLILSDLLGGTPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMAHSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEDFESGI GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 3->103|PTNAB_STRP6|1e-17|39.6|101/330| BL:PDB:NREP 1 BL:PDB:REP 3->122|1pdoA|4e-14|38.1|118/129| RP:PDB:NREP 1 RP:PDB:REP 3->123|3bedA|7e-22|23.4|111/121| RP:PFM:NREP 1 RP:PFM:REP 3->111|PF03610|1e-13|45.8|107/117|EIIA-man| HM:PFM:NREP 1 HM:PFM:REP 2->114|PF03610|4.2e-35|42.3|111/116|EIIA-man| GO:PFM:NREP 2 GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF03610|IPR004701| GO:PFM GO:0016021|"GO:integral to membrane"|PF03610|IPR004701| RP:SCP:NREP 1 RP:SCP:REP 2->123|3bedA1|3e-27|28.6|119/132|c.54.1.1| HM:SCP:REP 1->126|1pdoA_|1.4e-26|39.5|124/129|c.54.1.1|1/1|IIA domain of mannose transporter, IIA-Man| OP:NHOMO 367 OP:NHOMOORG 197 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------1---------11-1-------1--323333----------------------61-1271121433--42-3312211121233333223333333233322222122122222221112222---25-------3-2-1---122---2-3--------------11--1-1-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------111-1-------------------------------1-----------------------------1------------211122-1333133322-3112333232343221223111112211211111111111111-22133221-111111111211--1---------------2221121----1111----------------------------------------112--------12---------------------------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 88.7 SQ:SECSTR #EEEEEEETTHHHHHHHHHHcHHcTTccccEEEEcTTTHHHHHHHHHHHHHHHccccEEEEEccTcHHHHHHHTTcTTHHcTTEEEEEcccHHHHHHHHccccHHcHHHHHHHHHHHHHHTcccccH############### DISOP:02AL 131-137,139-139| PSIPRED cEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //