[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55125.1
DDBJ      :             methylated-DNA-[protein]-cysteine S-methyltransferase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  714/915 : Eukaryota  77/199 : Viruses  1/175   --->[See Alignment]
a.4.2c.55.7
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->163 1mgtA PDBj 9e-16 38.4 %
:RPS:PDB   9->167 1eh6A PDBj 4e-38 27.0 %
:RPS:SCOP  9->87 1eh6A2  c.55.7.1 * 1e-13 19.4 %
:RPS:SCOP  83->167 1eh6A1  a.4.2.1 * 3e-29 34.1 %
:HMM:SCOP  4->88 1qntA2 c.55.7.1 * 3.6e-12 31.0 %
:HMM:SCOP  81->163 1mgtA1 a.4.2.1 * 3.2e-28 55.6 %
:RPS:PFM   85->164 PF01035 * DNA_binding_1 7e-22 56.2 %
:HMM:PFM   83->165 PF01035 * DNA_binding_1 3.7e-32 49.4 83/85  
:BLT:SWISS 10->167 OGT_HAEIN 4e-25 36.4 %
:PROS 132->138|PS00374|MGMT
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55125.1 GT:GENE ACF55125.1 GT:PRODUCT methylated-DNA-[protein]-cysteine S-methyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1346739..1347251) GB:FROM 1346739 GB:TO 1347251 GB:DIRECTION - GB:PRODUCT methylated-DNA-[protein]-cysteine S-methyltransferase GB:NOTE identified by match to protein family HMM PF01035; match to protein family HMM TIGR00589 GB:PROTEIN_ID ACF55125.1 GB:DB_XREF GI:194356677 LENGTH 170 SQ:AASEQ MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDETIEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAPIGTNFEKRVWDYLQGIPYGQTVTYGQIAQDLQVASAQAIGGAVGRNPWSILVPCHRVLGAGKRLTGYAAGVEKKAWLLEHEGVDFKDINK GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 10->167|OGT_HAEIN|4e-25|36.4|154/179| PROS 132->138|PS00374|MGMT|PDOC00320| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 37->163|1mgtA|9e-16|38.4|125/169| RP:PDB:NREP 1 RP:PDB:REP 9->167|1eh6A|4e-38|27.0|152/168| RP:PFM:NREP 1 RP:PFM:REP 85->164|PF01035|7e-22|56.2|80/85|DNA_binding_1| HM:PFM:NREP 1 HM:PFM:REP 83->165|PF01035|3.7e-32|49.4|83/85|DNA_binding_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 2 RP:SCP:REP 9->87|1eh6A2|1e-13|19.4|72/78|c.55.7.1| RP:SCP:REP 83->167|1eh6A1|3e-29|34.1|85/90|a.4.2.1| HM:SCP:REP 4->88|1qntA2|3.6e-12|31.0|84/0|c.55.7.1|1/1|Methylated DNA-protein cysteine methyltransferase domain| HM:SCP:REP 81->163|1mgtA1|3.2e-28|55.6|81/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 1147 OP:NHOMOORG 825 OP:PATTERN ------1-111111111-----11--------1--11---1-11--1--111111111111---1--1 113-21-1111--111111-111112111111211112221111121211212----1--1111--232211111111-1211-----111111111--112111312-3--------1-----111111---1--111111111-2--111----1---------1111----------------1111111211111221112222222222211211131223233323211111111111111111111111-11-1211111111111---1-1111111111111111111111-------------1111--11111121111111121111211-11-21111---113311-111-11111-1111-4442-1111114222113332111111111113---1111-1-41-3333332332331-1-11231-121221111111121111112------------1-11112---11------1-2-1322233333332223233332122226232334112231111211222122211123111111111211-12-1-11-1111--1111-11111122122211211111111111111111112--11223211--1-111122122112111-111111---21-1------22211312222222212-222222222222122222121233112222222222222222212212222--122222212222--1112111222111212111111111111111111111111111223122332111111111111111111111211111-111112111111111111--11111111--------111-------1----------1-1-----1-1-11111-22 ----11--21---111----11----1-------------------11111111111------1--1--1-111111111111111------------------------1---------111112-1-241-111-1-12-111-11--1----1-11----31-----41-5--1------1-1---1--1-11--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 162 STR:RPRED 95.3 SQ:SECSTR ########EEccTTccEEEEEETTEEEEEEEcccccccccccccTTccccccHHHHHHHHHHHHHHHcGGGGGGccHHHHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTcTcHHHHHHHTTcccccTTccGGGEEcTTccccccTTcHHHHHHHHHHTTcccccTTc DISOP:02AL 1-3,167-171| PSIPRED ccccEEEEEEEcccEEEEEEEEccEEEEEEEccccHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccEEcHHHHHHHcccccHHHHHHHHHHccccEEccccEEEccccccccccccHHHHHHHHHHcccEEHHccc //