[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF55129.1
DDBJ      :             galactokinase
Swiss-Prot:GAL1_STRR6   RecName: Full=Galactokinase;         EC=2.7.1.6;AltName: Full=Galactose kinase;

Homologs  Archaea  10/68 : Bacteria  329/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->391 1pieA PDBj e-112 57.9 %
:RPS:PDB   1->391 2a2cA PDBj 7e-73 27.2 %
:RPS:SCOP  11->206 1wuuA1  d.14.1.5 * 2e-53 30.6 %
:RPS:SCOP  209->391 1pieA2  d.58.26.7 * 2e-41 62.3 %
:HMM:SCOP  1->208 1wuuA1 d.14.1.5 * 1.2e-60 42.4 %
:HMM:SCOP  209->391 1pieA2 d.58.26.7 * 2.2e-61 44.8 %
:RPS:PFM   11->62 PF10509 * GalKase_gal_bdg 2e-13 59.6 %
:RPS:PFM   295->365 PF08544 * GHMP_kinases_C 2e-09 52.9 %
:HMM:PFM   12->62 PF10509 * GalKase_gal_bdg 1.3e-26 60.8 51/52  
:HMM:PFM   290->370 PF08544 * GHMP_kinases_C 2e-18 33.3 78/82  
:HMM:PFM   118->182 PF00288 * GHMP_kinases_N 1.7e-15 35.9 64/68  
:BLT:SWISS 1->392 GAL1_STRR6 0.0 94.4 %
:PROS 128->143|PS00012|PHOSPHOPANTETHEINE
:PROS 30->41|PS00106|GALACTOKINASE
:PROS 125->136|PS00627|GHMP_KINASES_ATP
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55129.1 GT:GENE ACF55129.1 GT:PRODUCT galactokinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1675502..1676680) GB:FROM 1675502 GB:TO 1676680 GB:DIRECTION - GB:PRODUCT galactokinase GB:NOTE identified by match to protein family HMM PF00288; match to protein family HMM PF08544; match to protein family HMM TIGR00131 GB:PROTEIN_ID ACF55129.1 GB:DB_XREF GI:194356681 LENGTH 392 SQ:AASEQ MTQHLTAETLRKDFLAVFGQEADQTFFSPGRINLIGEHTDYNGGHVFPAAISLGTYGAVRKRDDQVLRFYSANFEDKGIIEVPLADLKFEKEHNWTNYPKGVLHFLQKAGHVIDKGFDFYVYGNIPNGSGLSSSASLELLTGVVAEHLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDLKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLIKDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLVHTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEEVVGYAPSFYIAEVAGGTRVLD GT:EXON 1|1-392:0| SW:ID GAL1_STRR6 SW:DE RecName: Full=Galactokinase; EC=2.7.1.6;AltName: Full=Galactose kinase; SW:GN Name=galK; OrderedLocusNames=spr1668; SW:KW ATP-binding; Carbohydrate metabolism; Complete proteome; Cytoplasm;Galactose metabolism; Kinase; Nucleotide-binding; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|GAL1_STRR6|0.0|94.4|392/392| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006012|"GO:galactose metabolic process"|Galactose metabolism| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 128->143|PS00012|PHOSPHOPANTETHEINE|PDOC00012| PROS 30->41|PS00106|GALACTOKINASE|PDOC00099| PROS 125->136|PS00627|GHMP_KINASES_ATP|PDOC00545| SEG 128->142|gsglsssaslelltg| BL:PDB:NREP 1 BL:PDB:REP 10->391|1pieA|e-112|57.9|382/388| RP:PDB:NREP 1 RP:PDB:REP 1->391|2a2cA|7e-73|27.2|383/446| RP:PFM:NREP 2 RP:PFM:REP 11->62|PF10509|2e-13|59.6|52/52|GalKase_gal_bdg| RP:PFM:REP 295->365|PF08544|2e-09|52.9|68/82|GHMP_kinases_C| HM:PFM:NREP 3 HM:PFM:REP 12->62|PF10509|1.3e-26|60.8|51/52|GalKase_gal_bdg| HM:PFM:REP 290->370|PF08544|2e-18|33.3|78/82|GHMP_kinases_C| HM:PFM:REP 118->182|PF00288|1.7e-15|35.9|64/68|GHMP_kinases_N| RP:SCP:NREP 2 RP:SCP:REP 11->206|1wuuA1|2e-53|30.6|193/215|d.14.1.5| RP:SCP:REP 209->391|1pieA2|2e-41|62.3|183/183|d.58.26.7| HM:SCP:REP 1->208|1wuuA1|1.2e-60|42.4|205/0|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 209->391|1pieA2|2.2e-61|44.8|183/183|d.58.26.7|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 576 OP:NHOMOORG 460 OP:PATTERN --1--------------111---------1-------------------------11-111------- 111-1-1----11-111-------11-----1----11111111111-111-1111-1----11111111-11111111---------1111-111----11-1-111-1--------------------------11111---1----1-------------------1-------------11-111111-2-------1-------111111---111--1--------2---------------1---1111-11-1111111112112131111----11111111111111111-------------111111111-1--11----------1----11111----11--------1---1111-11-----------------------------------------------1--------------------------------------------------------------------------11-----------------------------------------1----------------------------1-------------1----1-1-----------1-----------------------------1211-1--1111121211111112122113-------------11111111111111111-11-1111111111--11-1111111111111111111111111111111111-111111111111------------------111111-11111-11-----------1-----------------111111111--1111111111-11-----------------2111-11--------31--------------------------1111111111-11 ----111----------11---11111----------------11111----111-11----1---11---1--11--1-11111111-1----11------1111-22-432222-2-2--2133142573-433-21-21212-11--21142322223322322313211321--2E1111122231221111421 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 392 STR:RPRED 100.0 SQ:SECSTR GGGcHHHHHHHHHHHHHHcccccEEEEEEEEEEEEcTTcGGGTcccEEEEEEEEEEEEEEEcccccEEEEEccTTcccEcEEEcccccccccccHHHHHHHHHHHHHHTTccccccEEEEEEEcccTTccccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHGGGGTcccccHHHHHHHHccTTcEEEEETTTTEEEEEcccTTEEEEEEEccccccGGGccHHHHHHHHHHHHHHHHcccHHTccHHHHHHHTccGGGTTcccccHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHTTccEEEEcTTccccEEEEEEEGGGHHHHHHHHHHHHHHHcHccccEEEEccccccEEEE DISOP:02AL 1-7,392-393| PSIPRED ccccHHHHHHHHHHHHHHcccccEEEEEcEEEEEEcccEEEcccEEEEEEEccEEEEEEEEccccEEEEEEccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHcccccEEEEEEcccccEEEEEEccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEcc //